DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and CG9259

DIOPT Version :8

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster

Alignment Length:450 Identity:106/450 (24%)
Similarity:184/450 (41%) Gaps:86/450 (19%)


  Fly     1 MCSIVFDADVVAPPSHLDVPFFEEVLETALRTARVQLLSIHIRMGSSTGENYCSQIYRVKVSFKR 65
            :|...|..||    |:.|..|              .:::..::..|.....|......:.|:.|.
  Fly    15 LCQRYFHQDV----SNSDTGF--------------DIVNYTLKPTSDAPAGYLGSHLYLHVTLKL 61

  Fly    66 PDHPE-QHMAFIVKSIP--HLDSVEFIDDLQVYLKEKITYYEVLPRLELLMQCNRRFGPKLYHYL 127
            .:..| :.:.|..||.|  :...:|:::|..|:.||...|..|||  :|...| ....||.|:  
  Fly    62 HNSEEVRQLTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLP--DLHKAC-AEVAPKCYY-- 121

  Fly   128 KQPENSLVFEDLAEKGFVMASRELGL---NEEHCQLVMERLAEFHA--------TSMALAVVDPH 181
             ..:|.|:||:||::|:.|.:...||   .:.||  .::.||..||        |...:|...|.
  Fly   122 -ADKNLLIFENLADQGYRMGAGRDGLLTYEQLHC--CLKTLAAMHAGSIIQEQRTGQKIAQSQPK 183

  Fly   182 --IFDAYGDGMLSPRGLAKDDGLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKYMQNQRANLE- 243
              :.:||... :||      :.:.|..|......|...:...|   |...|:...::|....:. 
  Fly   184 SVVENAYPSD-VSP------EHMRMVNFQNACLVLKEFIKLIP---KYQSKLDYVLENFTEKMSF 238

  Fly   244 RSQAPQEKEV--KVLNHGDLWVNNMLFKYDG-AQRPQDLILIDFQLSVWGSPGIDLNYFFYTSLT 305
            ..:|.:..:|  ..:.|||||.||::|:|.. .:.|....|:||||:.:..|.:|:    .|.||
  Fly   239 IFEAVKTSDVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDV----LTVLT 299

  Fly   306 LEVLRHRR----TQLLRTYHARLAKTL--LDLDMGIPVPSYEQILEEVHRRESYG-----FFASY 359
            :...:..|    ::||..|:..:.:.|  .|||:...:|. :...|.|.:..|.|     .|...
  Fly   300 IPTSKEFRDAHLSELLAEYYRFMTEFLKRADLDIARFIPE-QTFYESVQKFRSVGLIESCLFCHL 363

  Fly   360 GIFPTVSQDKAQTADNNLENFKDADFAKQKVR---------QMFQSRRLADTLRYTLPHF 410
            .|.|.....|..::.:...:|    |..:::.         ::::| ||.|.:...:..|
  Fly   364 VILPPHCTQKLTSSVDGFNDF----FTNKRIEICLEAFNTDELYRS-RLVDMIEDFVDQF 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 80/308 (26%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 78/293 (27%)
APH <252..325 CDD:279908 24/77 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59702
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.