DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and CG31288

DIOPT Version :8

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster

Alignment Length:449 Identity:115/450 (26%)
Similarity:193/450 (43%) Gaps:72/450 (16%)


  Fly     9 DVVAPPSHLDVP------FFEEVLETALRTARVQLLSIHIRMGSSTGENYCSQIYRVKVSFKRPD 67
            |:|.|..||.:|      :||.||... ....|::|...:......|||:.|.:.||.:..:..|
  Fly     6 DIVNPNEHLIIPDWINEKYFESVLAKD-EPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKD 69

  Fly    68 HPEQHMAFIVKS-IPHLDSVEFIDDLQVYLKEKITYYEVLPRLELLMQ---CNRRFGPKLYHYLK 128
            ...:...:|.|: :|.......|::..::.||.:.|...||..|.|.:   .:.:..||..| .:
  Fly    70 GSVKTKTYIFKTMLPEERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLH-TE 133

  Fly   129 QPENSL--VFEDLAEKGFVMASRELGLNEEHCQLVMERLAEFHATSMALAVVDPHIFDAYGDGML 191
            :.|..:  :||||..|.|....|..||:.||....:::|||:||.|.....:.......:.:|.:
  Fly   134 EREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSEFSEGFV 198

  Fly   192 SPRGLAKD------DGLLMQ-------FFSGNGKELHHLVSTWPGFEKIAEKIGKYMQNQRANLE 243
            .     ||      ||..::       ..|...|:....:..:|       .:.:|.....:.||
  Fly   199 K-----KDVKKFHVDGFQLKEKAYKKAMLSWGLKDADKYIKAFP-------TVKQYWAQCLSTLE 251

  Fly   244 RSQAPQEKEVKVLNHGDLWVNNMLFKY--DGAQRPQDLILIDFQLSVWGSPGIDLNYFFYTSLTL 306
            .:    ..|..||||||.|.:|::..|  ||..  :.|||||||:.:||||.:||.:|...|.|.
  Fly   252 LN----PDEFHVLNHGDFWSSNLMSSYLPDGTL--EKLILIDFQIVMWGSPAMDLLFFLTLSPTN 310

  Fly   307 EVLRHRRTQLLRTYHARLAKTLLDLDMGIPVPSYEQILEEVHRRESYGFFASYGI--------FP 363
            ::........:|.|..||.:.|..|.:..|:|....:...::.: ::.|:|.:.|        ||
  Fly   311 DLRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNK-NHSFYAFFSILNHLPIILFP 374

  Fly   364 TVSQDKAQTADNNLENFKDADFAKQKVRQMFQSRRLA-----DTLRYTLPHFERAGVLD 417
            |   ||    |:|:.|..    |..:..:.::.|.|:     :.::...|.....|:|:
  Fly   375 T---DK----DSNIHNLS----ANTEEGENYRLRLLSNPAFGNVMKDLYPFLYNRGILN 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 83/303 (27%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 82/300 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55263
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.