DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and nhr-246

DIOPT Version :8

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans

Alignment Length:439 Identity:89/440 (20%)
Similarity:162/440 (37%) Gaps:126/440 (29%)


  Fly    18 DVPFFEEVLETALRTARVQLLSIHIRMGSSTG-----EN----YCSQIYRVKVSFKRPDHPEQHM 73
            ::|..:|.|        .:|:.|.|.:....|     ||    :.|.:.:|::.|...|.|:..:
 Worm     8 NIPLTKEWL--------AELIEIKIGVKPKIGTVGILENSELGFMSLLRKVRLHFDNDDLPKHVV 64

  Fly    74 AFI----------------VKSIPHLDSVEFIDDLQVYLKEKITYYEVLPRL-ELLMQCNRRFGP 121
            ..|                ||::.|.....|:.:.:      ..||::...| |..:|.     |
 Worm    65 LKIPQNTKGCSVVENAGGGVKNVDHSVVERFMHNTE------CNYYKLFSSLSEKPLQI-----P 118

  Fly   122 KLYHYLKQPENS----LVFEDLAEKGFVMASREL--GLNEEHCQLVMERLAEFHATSMAL---AV 177
            ..|...|..|.:    :|.|.|.:    ....:|  |.||:....:::.|.:.|..|:..   ..
 Worm   119 TTYLASKAGEKAPVPVIVLEMLED----CKLHDLIPGFNEDQLFKIVDELVKLHIFSLTTEKWKE 179

  Fly   178 VDPHIFDAYGDGMLS------PRGLAKDD--GLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKY 234
            :.|........|.|.      .|.||::.  |:::.:       :.:.:.|.|          .|
 Worm   180 IVPDESKLAMSGFLQCMVADVGRKLAQNPELGVILSY-------VENTLDTDP----------NY 227

  Fly   235 MQNQRANLERSQAPQEKEVKVLNHGDLWVNNMLFKYDGAQRPQDLI--LIDFQLSVWGSPGIDLN 297
            :|..|......:.|     .|:.|||||...:|:.      .:|.|  ::|:|.:..|||..||:
 Worm   228 LQKMRDEYINEERP-----SVICHGDLWAPQILWD------KEDNIAGIVDWQATHRGSPMEDLH 281

  Fly   298 YFFYTSLTLEVLRHRRTQLLRTYHARLAKTLLD-----LDMGIPVPSYEQ--ILEEVHRRESYGF 355
            :...|..:::   :|:|         ..|.|||     |.:|:....::.  ..||:....:|.|
 Worm   282 HILSTCTSVQ---NRKT---------FTKPLLDHYYNKLKVGLKEKGFKTTWTREEIDIEYNYSF 334

  Fly   356 F--ASYGIF--------PTVSQDKAQTADNNLENF-KDADFAKQKVRQM 393
            .  ||..||        |.:..|.....:...|:| :...:.:..:|::
 Worm   335 IYGASRTIFANGFWANSPVLQTDGKPDPERIKESFVRCKSYLEDTIREL 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 68/332 (20%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 48/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4046
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.