DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and T16G1.5

DIOPT Version :8

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_506235.1 Gene:T16G1.5 / 179775 WormBaseID:WBGene00011799 Length:434 Species:Caenorhabditis elegans

Alignment Length:462 Identity:96/463 (21%)
Similarity:171/463 (37%) Gaps:118/463 (25%)


  Fly    14 PSHLDVPFFEEVLETALRTARVQLL-----SIHIRMGSST-------GENYCSQIYRVKVSFKRP 66
            ||.:|..  :.:.||.::...:|:|     :...::|..|       |..:.|::..|:..:..|
 Worm     6 PSIIDNG--DGLFETHVKLEDIQILIKEQMNTDSKLGEKTKLTVVGDGNGFMSRVVLVEADWTIP 68

  Fly    67 DH--PEQHMAFIVKSIPHLDSVEFIDDLQVYLKEK----------------------------IT 101
            :.  ||       |.|..|.|...:..|...:|||                            :.
 Worm    69 NENLPE-------KIILKLTSCINVHHLVSQMKEKNPDAFTEQQEAELWAMFEREAQNVHNREVN 126

  Fly   102 YYEVLPRLELLMQCNRRFGPKLYHYLK-QPEN------SLVFEDLAEKGFVMASRELGLNEEHCQ 159
            .|.:   .|...:.:....||:|.|.| ..||      .:.:.|.|      ..|.|..|.:..:
 Worm   127 LYRI---TEKWNKNDALLSPKIYFYKKFDCENKTQGVLGMEYVDDA------VVRHLYCNAKPHE 182

  Fly   160 L--VMERLAEFHATSMALAVVDPHIFDAYGDGMLSPRGLAKDDGLLMQFFSGNGKELHHLVSTWP 222
            |  :::.||...|.|:.|...:.:....|....:..| :..::|:...:..........|.....
 Worm   183 LHPILQSLATLQAGSLHLTEDEINSISGYDFKSMVGR-MMSEEGMKQMYTRARQINPERLTKPTD 246

  Fly   223 GFEKIAEKIGKY----MQNQRANLERSQAPQEKEVKVLNHGDLWVNNMLFK-YDG---AQRPQDL 279
            ..|.:...|..:    ..|:.|.::::         ||.|||||..|:|:| .||   |.:    
 Worm   247 AVEALGMDIVNFEISCHVNKYAGIQKN---------VLVHGDLWAANILWKENDGNCVASK---- 298

  Fly   280 ILIDFQLSVWGSPGIDLNYFFYTSLTLEVLRHRRTQLLRTYHARLAKTLLDLDMGIPVP-SYEQI 343
             :||:||...|:|..||...|.::|:....:....:||..::....:.|    .|...| :.:|:
 Worm   299 -VIDYQLIHMGNPAEDLVRVFLSTLSGADRQAHWEKLLEQFYEYFLEAL----EGNEAPYTLDQL 358

  Fly   344 LEEVHRRESYG-FFASYGIF------PTVSQDKAQTADN-NLENFKDADFAKQKVRQMFQSRRLA 400
                  :|||. :|...|:|      |......:.:.|| |:|.:::....|.:       |.:.
 Worm   359 ------KESYRLYFVGGGLFVMPLFGPVAQAKLSYSTDNENVEEYREVLTEKAE-------RLME 410

  Fly   401 DTLRYTL 407
            |..|:.|
 Worm   411 DLKRWHL 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 68/329 (21%)
T16G1.5NP_506235.1 DUF1679 8..420 CDD:285194 94/461 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.