DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and ZSCAN10

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_116194.2 Gene:ZSCAN10 / 84891 HGNCID:12997 Length:780 Species:Homo sapiens

Alignment Length:511 Identity:140/512 (27%)
Similarity:216/512 (42%) Gaps:96/512 (19%)


  Fly     2 TESKNDTKSWAPK-QIWIKDVLKKSGTELLDISKSP-AKAV---AVKKSPAKDSATTKMVYYSAN 61
            |..|.:.|...|| ..|...:|.:|..:...:...| |:::   |....|.:|.:          
Human   268 TPDKEEFKQEEPKGAAWPTPILAESQADSPGVPGEPCAQSLGRGAAASGPGEDGS---------- 322

  Fly    62 QLLIKTEQSSQAQFCLQVP---PPLTATTTSVGLGVPPSGGQQEHFELLQTPQQRQ--------- 114
              |:.:.:..:.:....||   |.|.......|:..|.....:.| :|...|..|.         
Human   323 --LLGSSEILEVKVAEGVPEPNPELQFICADCGVSFPQLSRLKAH-QLRSHPAGRSFLCLCCGKS 384

  Fly   115 ------MQLQLQDQHQQEQQQFVSYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGG 173
                  ::|.:: .|..|:..  :..|...:.::.....:| .:|:::..|...|     |...|
Human   385 FGRSSILKLHMR-THTDERPH--ACHLCGHRFRQSSHLSKH-LLTHSSEPAFLCA-----ECGRG 440

  Fly   174 FPASAAVV------SQVRKPSASKPQFK----------CDQCGMTFGSKSAHTSHTKSHSKNQDL 222
            |...|::|      :|.:||..: |:.|          |..||.:|..:|:...|.:.|::::|.
Human   441 FQRRASLVQHLLAHAQDQKPPCA-PESKAEAPPLTDVLCSHCGQSFQRRSSLKRHLRIHARDKDR 504

  Fly   223 SLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLI 287
            ..:..||:           ...|                    :...|:.|:.|.|.|.....|:
Human   505 RSSEGSGS-----------RRRD--------------------SDRRPFVCSDCGKAFRRSEHLV 538

  Fly   288 RHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGE 352
            .|.|.|||||||.|:.|.:.|:....|..|:|:||.|:||.|..||:.|.....|.||:..|.|.
Human   539 AHRRVHTGERPFSCQACGRSFTQSSQLVSHQRVHTGEKPYACPQCGKRFVRRASLARHLLTHGGP 603

  Fly   353 RPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDI 417
            |||.|:.|.|:|.|:..|..|.|:||||||.:|.|  ||:||:.|..|..|.|.||||||:.||.
Human   604 RPHHCTQCGKSFGQTQDLARHQRSHTGEKPCRCSE--CGEGFSQSAHLARHQRIHTGEKPHACDT 666

  Fly   418 CFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKGHANEVPDDEAE 473
            |...|..:..|..||..|.|.:.|.|..|..:|:....:..|:..|| |...::||
Human   667 CGHRFRNSSNLARHRRSHTGERPYSCQTCGRSFRRNAHLRRHLATHA-EPGQEQAE 721

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 6/20 (30%)
COG5048 <270..420 CDD:227381 71/150 (47%)
zf-C2H2 271..293 CDD:278523 7/22 (32%)
C2H2 Zn finger 273..293 CDD:275368 7/20 (35%)
zf-H2C2_2 286..309 CDD:290200 13/23 (57%)
C2H2 Zn finger 301..321 CDD:275368 6/20 (30%)
zf-H2C2_2 313..338 CDD:290200 12/25 (48%)
C2H2 Zn finger 329..349 CDD:275368 7/20 (35%)
zf-H2C2_2 344..366 CDD:290200 11/22 (50%)
C2H2 Zn finger 357..377 CDD:275368 8/20 (40%)
zf-H2C2_2 370..396 CDD:290200 15/26 (58%)
C2H2 Zn finger 385..407 CDD:275368 10/22 (45%)
zf-H2C2_2 400..424 CDD:290200 13/24 (54%)
C2H2 Zn finger 415..435 CDD:275368 7/20 (35%)
zf-C2H2 441..463 CDD:278523 5/22 (23%)
C2H2 Zn finger 443..463 CDD:275368 4/20 (20%)
ZSCAN10NP_116194.2 SCAN 40..124 CDD:153421
PHA03418 156..>314 CDD:177646 11/46 (24%)
C2H2 Zn finger 349..370 CDD:275368 4/22 (18%)
C2H2 Zn finger 378..398 CDD:275368 1/21 (5%)
zf-H2C2_2 391..415 CDD:290200 4/27 (15%)
COG5048 400..774 CDD:227381 114/366 (31%)
C2H2 Zn finger 406..426 CDD:275368 3/21 (14%)
C2H2 Zn finger 434..454 CDD:275368 6/25 (24%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
zf-C2H2 522..544 CDD:278523 7/22 (32%)
C2H2 Zn finger 524..544 CDD:275368 7/20 (35%)
zf-H2C2_2 536..561 CDD:290200 13/25 (52%)
C2H2 Zn finger 552..572 CDD:275368 6/20 (30%)
zf-H2C2_2 565..589 CDD:290200 12/24 (50%)
C2H2 Zn finger 580..600 CDD:275368 7/20 (35%)
zf-H2C2_2 592..615 CDD:290200 11/23 (48%)
C2H2 Zn finger 608..628 CDD:275368 8/20 (40%)
zf-H2C2_2 620..645 CDD:290200 15/27 (56%)
C2H2 Zn finger 636..656 CDD:275368 10/22 (45%)
zf-H2C2_2 648..673 CDD:290200 13/25 (52%)
C2H2 Zn finger 664..684 CDD:275368 7/20 (35%)
zf-H2C2_2 676..701 CDD:290200 9/25 (36%)
C2H2 Zn finger 692..712 CDD:275368 4/20 (20%)
C2H2 Zn finger 728..746 CDD:275368
zf-H2C2_2 738..763 CDD:290200
zf-C2H2 752..774 CDD:278523
C2H2 Zn finger 754..774 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.