DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and ZNF132

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_003424.3 Gene:ZNF132 / 7691 HGNCID:12916 Length:706 Species:Homo sapiens

Alignment Length:362 Identity:120/363 (33%)
Similarity:176/363 (48%) Gaps:33/363 (9%)


  Fly   132 SYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFKC 196
            |:...:::|||...:.::........|               |......|...|..|..:| ::|
Human   301 SHSSKLRKHQKFHTEVKYYECIACGKT---------------FNHKLTFVHHQRIHSGERP-YEC 349

  Fly   197 DQCGMTFGSKSAHTSHTKSHSKNQDL-----------SLNGASGAGVAAPVSTAAIELNDAGLPV 250
            |:||..|.::|....|.|.|:..:..           |.|......|...|  ...|.:..|  .
Human   350 DECGKAFSNRSHLIRHEKVHTGERPFECLKCGRAFSQSSNFLRHQKVHTQV--RPYECSQCG--K 410

  Fly   251 GIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQ 315
            ...:|..:.....|..|..||:|:.|.:.|...:.|.:|.:.|||||||||..|.:.||...:|.
Human   411 SFSRSSALIQHWRVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLL 475

  Fly   316 VHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGE 380
            .|:::||.|||::|..||:||.:|..|.:|.::|||:||::||.|.|:|.:|..|:.|.|.||||
Human   476 RHQKVHTGERPFECCDCGKAFSNSSTLIQHQKVHTGQRPYECSECRKSFSRSSSLIQHWRIHTGE 540

  Fly   381 KPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTI 445
            |||:|.|  |||.|..|..|..|.|.||.|:||.|:.|.:.|..|.:|..|:..|.|.|.|||:.
Human   541 KPYECSE--CGKAFAHSSTLIEHWRVHTKERPYECNECGKFFSQNSILIKHQKVHTGEKPYKCSE 603

  Fly   446 CDETFKNKKEMEAHIKGHANEVPDDEAEAAAASAAAS 482
            |.:.|..|..:..|.:.|..|.|.:.:|...|.::.|
Human   604 CGKFFSRKSSLICHWRVHTGERPYECSECGRAFSSNS 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 8/20 (40%)
COG5048 <270..420 CDD:227381 72/150 (48%)
zf-C2H2 271..293 CDD:278523 6/22 (27%)
C2H2 Zn finger 273..293 CDD:275368 5/20 (25%)
zf-H2C2_2 286..309 CDD:290200 13/23 (57%)
C2H2 Zn finger 301..321 CDD:275368 6/20 (30%)
zf-H2C2_2 313..338 CDD:290200 12/25 (48%)
C2H2 Zn finger 329..349 CDD:275368 8/20 (40%)
zf-H2C2_2 344..366 CDD:290200 11/22 (50%)
C2H2 Zn finger 357..377 CDD:275368 9/20 (45%)
zf-H2C2_2 370..396 CDD:290200 16/26 (62%)
C2H2 Zn finger 385..407 CDD:275368 10/22 (45%)
zf-H2C2_2 400..424 CDD:290200 11/24 (46%)
C2H2 Zn finger 415..435 CDD:275368 6/20 (30%)
zf-C2H2 441..463 CDD:278523 7/22 (32%)
C2H2 Zn finger 443..463 CDD:275368 5/20 (25%)
ZNF132NP_003424.3 KRAB 37..78 CDD:307490
COG5048 105..528 CDD:227381 73/247 (30%)
C2H2 Zn finger 116..136 CDD:275368
C2H2 Zn finger 144..164 CDD:275368
C2H2 Zn finger 238..285 CDD:275368
C2H2 Zn finger 293..313 CDD:275368 4/12 (33%)
C2H2 Zn finger 321..341 CDD:275368 4/35 (11%)
C2H2 Zn finger 349..369 CDD:275368 8/20 (40%)
C2H2 Zn finger 377..397 CDD:275368 3/20 (15%)
COG5048 383..>706 CDD:227381 101/265 (38%)
C2H2 Zn finger 405..425 CDD:275368 3/22 (14%)
C2H2 Zn finger 433..453 CDD:275368 5/20 (25%)
C2H2 Zn finger 461..481 CDD:275368 6/20 (30%)
C2H2 Zn finger 489..509 CDD:275368 8/20 (40%)
C2H2 Zn finger 517..537 CDD:275368 9/20 (45%)
C2H2 Zn finger 545..565 CDD:275368 10/22 (45%)
C2H2 Zn finger 573..593 CDD:275368 6/20 (30%)
C2H2 Zn finger 601..621 CDD:275368 5/20 (25%)
C2H2 Zn finger 629..649 CDD:275368 3/13 (23%)
C2H2 Zn finger 657..677 CDD:275368
C2H2 Zn finger 685..705 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.