DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Zscan25

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001074900.1 Gene:Zscan25 / 666311 MGIID:3647079 Length:543 Species:Mus musculus

Alignment Length:365 Identity:120/366 (33%)
Similarity:156/366 (43%) Gaps:52/366 (14%)


  Fly   143 QQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKP--------------SASKPQ 193
            |..|:|...|.:..| ..||......|...||   .|..||...|              ..:..|
Mouse   190 QAFQEQALPILHVGP-GLPSVSARDQEMAAGF---LAATSQGLGPFKDMTLGFPEEEWRHVAPAQ 250

  Fly   194 FKC-------DQCGMTFGS--------------KSAHTSHTKSHSKNQDLSLNGASGAGVAAPVS 237
            ..|       ..||:..|:              |.|....|.......|:.:.|..|.....|.|
Mouse   251 IDCFGEYVDSQDCGVLPGAGSKEKEAKPQQEDLKRAFVGLTSDGFGEADIQIPGPGGTCEQEPGS 315

  Fly   238 TAAIELNDAGLPV---GIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPF 299
            :..   :..|||.   |:|...|:....:.   ..|:||..|.|.|:..:.|:||.|||..|:.|
Mouse   316 SGT---SLPGLPAPQHGVPLPDTLNTHNSF---WKPFQCPECGKGFSRSSNLVRHQRTHEEEKSF 374

  Fly   300 ECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTF 364
            .|..|.|.|:::|.|..|:|.|..:|||.|..|.:.|.....|..|.|.||||:|:|||.|.|.|
Mouse   375 GCVECGKGFTLREYLTKHQRTHLGKRPYVCGECWKTFSQRHHLEVHQRSHTGEKPYKCSDCWKGF 439

  Fly   365 IQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLK 429
            .:...|::|.|||||||||.|.   |||.|:.:..|.||.|.|||||||.|.:|.:.|.....|.
Mouse   440 SRRQHLLVHRRTHTGEKPYTCE---CGKSFSRNANLAVHRRAHTGEKPYGCQVCGKRFSKGERLV 501

  Fly   430 LHRVQHYGSKCYKCTICDETFKNKKEMEAHIK-GHANEVP 468
            .|:..|.|.|.|.|..|..:|..:..:..|.| .|..|.|
Mouse   502 RHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQEPP 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 7/41 (17%)
COG5048 <270..420 CDD:227381 72/150 (48%)
zf-C2H2 271..293 CDD:278523 10/22 (45%)
C2H2 Zn finger 273..293 CDD:275368 9/20 (45%)
zf-H2C2_2 286..309 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 8/20 (40%)
zf-H2C2_2 313..338 CDD:290200 10/25 (40%)
C2H2 Zn finger 329..349 CDD:275368 6/20 (30%)
zf-H2C2_2 344..366 CDD:290200 13/22 (59%)
C2H2 Zn finger 357..377 CDD:275368 9/20 (45%)
zf-H2C2_2 370..396 CDD:290200 16/26 (62%)
C2H2 Zn finger 385..407 CDD:275368 9/22 (41%)
zf-H2C2_2 400..424 CDD:290200 14/24 (58%)
C2H2 Zn finger 415..435 CDD:275368 5/20 (25%)
zf-C2H2 441..463 CDD:278523 6/23 (26%)
C2H2 Zn finger 443..463 CDD:275368 5/21 (24%)
Zscan25NP_001074900.1 SCAN 38..120 CDD:280241
KRAB_A-box 230..>258 CDD:143639 3/28 (11%)
COG5048 <338..531 CDD:227381 82/199 (41%)
zf-C2H2 346..368 CDD:278523 10/22 (45%)
C2H2 Zn finger 348..368 CDD:275368 9/20 (45%)
C2H2 Zn finger 376..396 CDD:275368 8/20 (40%)
zf-H2C2_2 388..413 CDD:290200 10/25 (40%)
C2H2 Zn finger 404..424 CDD:275368 6/20 (30%)
zf-H2C2_2 416..441 CDD:290200 14/25 (56%)
C2H2 Zn finger 432..452 CDD:275368 9/20 (45%)
zf-H2C2_2 444..468 CDD:290200 16/27 (59%)
C2H2 Zn finger 460..479 CDD:275368 9/22 (41%)
zf-H2C2_2 471..495 CDD:290200 14/24 (58%)
C2H2 Zn finger 487..507 CDD:275368 5/20 (25%)
zf-H2C2_2 500..524 CDD:290200 9/24 (38%)
C2H2 Zn finger 515..534 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.