DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Kr-h1 and pita

Sequence 1:NP_477466.1 Gene:Kr-h1 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster

Alignment Length:470 Identity:121/471 (26%)
Similarity:177/471 (38%) Gaps:98/471 (21%)


  Fly    19 KDVLKKSGTEL------------LDISKSPAKAVAVKK---SPAK---DSATTKMVYYSANQLLI 65
            |.:.|::.|.|            |:..::|...||.||   .|||   .|.|.|.        |:
  Fly    80 KQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKK--------LL 136

  Fly    66 KTEQSSQAQFCL---QVPPPLTATTTSVGLGVPPSGGQQEHFEL-LQTPQQRQM---QLQLQDQH 123
            .|...|.:|..:   ||......|..:|. |..|...:...:|| :...|:..|   |..|:|..
  Fly   137 NTMAKSSSQVIIEDVQVLESAMVTPRTVA-GSSPVPRRSHAYELKVDNNQELSMDDVQSMLEDMA 200

  Fly   124 QQEQQQFVSYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKPS 188
            .:.:::|..........:.:...:....|.|..| |||...|:.|                    
  Fly   201 SELEKEFPDIPQKASPVKPKVLNKSSIRILNKGP-AAPVEPRLAT-------------------- 244

  Fly   189 ASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIP 253
               |:.|.|..|                              .||     ...|:.|:.||:...
  Fly   245 ---PKVKRDDSG------------------------------NVA-----IVTEVLDSDLPLDDQ 271

  Fly   254 KSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHR 318
            ..|| |....||  .|.:.|..|:::|.:...|..|...||..|.|:|..|.|.|..|.:|..|.
  Fly   272 DDPT-KNAEKVA--TDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHN 333

  Fly   319 RIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPY 383
            .:||.|||:||.:|.:||.....||||.|.||......|..|||.|:...::..|...|..::|:
  Fly   334 FVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPF 398

  Fly   384 KCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDE 448
            :|..  |.|.|...:.|:.|...|:...|:.|..|.|.|.....|..|.|.|.|.:.|.|..|.:
  Fly   399 QCGV--CTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHK 461

  Fly   449 TFKNKKEMEAHIKGH 463
            ::.....:..|::.|
  Fly   462 SYMLSHHLSRHLRTH 476

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 2/20 (10%)
COG5048 <270..420 CDD:227381 51/150 (34%)
zf-C2H2 271..293 CDD:278523 5/22 (23%)
C2H2 Zn finger 273..293 CDD:275368 5/20 (25%)
zf-H2C2_2 286..309 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 7/20 (35%)
zf-H2C2_2 313..338 CDD:290200 12/25 (48%)
C2H2 Zn finger 329..349 CDD:275368 9/20 (45%)
zf-H2C2_2 344..366 CDD:290200 10/22 (45%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
zf-H2C2_2 370..396 CDD:290200 7/26 (27%)
C2H2 Zn finger 385..407 CDD:275368 6/22 (27%)
zf-H2C2_2 400..424 CDD:290200 8/24 (33%)
C2H2 Zn finger 415..435 CDD:275368 7/20 (35%)
zf-C2H2 441..463 CDD:278523 4/22 (18%)
C2H2 Zn finger 443..463 CDD:275368 3/20 (15%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 4/12 (33%)
COG5048 <281..506 CDD:227381 66/201 (33%)
C2H2 Zn finger 288..308 CDD:275368 5/20 (25%)
C2H2 Zn finger 316..336 CDD:275368 7/20 (35%)
zf-H2C2_2 328..353 CDD:290200 12/25 (48%)
C2H2 Zn finger 344..364 CDD:275368 9/20 (45%)
C2H2 Zn finger 372..388 CDD:275370 5/16 (31%)
C2H2 Zn finger 400..420 CDD:275368 6/22 (27%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
C2H2 Zn finger 456..476 CDD:275368 3/20 (15%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.