DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and ZNF530

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_065931.3 Gene:ZNF530 / 348327 HGNCID:29297 Length:599 Species:Homo sapiens

Alignment Length:490 Identity:143/491 (29%)
Similarity:198/491 (40%) Gaps:110/491 (22%)


  Fly    30 LDISKSPAKAVAVK-----KSPAKDSATTKMVYYSANQLLIKTEQSSQAQFCLQVPPPLTATTTS 89
            :|.....|::|:|:     ::|..|::|.|               |...:.|   .|.|......
Human    60 VDEGTPSAESVSVEELSQGRTPKADTSTDK---------------SHPCEIC---TPVLRDILQM 106

  Fly    90 VGLGVPPS------GGQQEHFELLQTPQQRQMQLQLQDQHQQ------EQQQFV----------- 131
            :.|...|.      ||....|.:    .....|||..|..::      :|..|:           
Human   107 IELHASPCGQKLYLGGASRDFWM----SSNLHQLQKLDNGEKLFKVDGDQASFMMNCRFHVSGKP 167

  Fly   132 ----------SYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIK-------------TEPVGG 173
                      |....:.|||             ..||......||:             ||....
Human   168 FTFGEVGRDFSATSGLLQHQ-------------VTPTIERPHSRIRHLRVPTGRKPLKYTESRKS 219

  Fly   174 FPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVST 238
            |...:..:...|..|..:| :||.:||.:|...|....|.|:|.:                   |
Human   220 FREKSVFIQHQRADSGERP-YKCSECGKSFSQSSGFLRHRKAHGR-------------------T 264

  Fly   239 AAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEF 303
            ...|.::.|  ....:...:.....|..|..||.|:.|.|:|...:.||:|.|.||||||:||..
Human   265 RTHECSECG--KSFSRKTHLTQHQRVHTGERPYDCSECGKSFRQVSVLIQHQRVHTGERPYECSE 327

  Fly   304 CHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSG 368
            |.|.||...||..||..||..|||:|..||::|.||..|.||.|:|||.||::||.|.|.|..:.
Human   328 CGKSFSHSTNLYRHRSAHTSTRPYECSECGKSFSHSTNLFRHWRVHTGVRPYECSECGKAFSCNI 392

  Fly   369 QLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRV 433
            .|:.|.|.||||:||.|.|  |||.|.....|..|.|.||||:||.|..|.:.|..:..|..||.
Human   393 YLIHHQRFHTGERPYVCSE--CGKSFGQKSVLIQHQRVHTGERPYECSECGKVFSQSSGLFRHRR 455

  Fly   434 QHYGSKCYKCTICDETFKNKKEMEAHIKGHANEVP 468
            .|..:|.|:|:.|:::|..|.::..|...|..|.|
Human   456 AHTKTKPYECSECEKSFSCKTDLIRHQTVHTGERP 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 7/20 (35%)
COG5048 <270..420 CDD:227381 77/150 (51%)
zf-C2H2 271..293 CDD:278523 9/22 (41%)
C2H2 Zn finger 273..293 CDD:275368 8/20 (40%)
zf-H2C2_2 286..309 CDD:290200 15/23 (65%)
C2H2 Zn finger 301..321 CDD:275368 9/20 (45%)
zf-H2C2_2 313..338 CDD:290200 13/25 (52%)
C2H2 Zn finger 329..349 CDD:275368 10/20 (50%)
zf-H2C2_2 344..366 CDD:290200 13/22 (59%)
C2H2 Zn finger 357..377 CDD:275368 8/20 (40%)
zf-H2C2_2 370..396 CDD:290200 15/26 (58%)
C2H2 Zn finger 385..407 CDD:275368 9/22 (41%)
zf-H2C2_2 400..424 CDD:290200 12/24 (50%)
C2H2 Zn finger 415..435 CDD:275368 6/20 (30%)
zf-C2H2 441..463 CDD:278523 6/22 (27%)
C2H2 Zn finger 443..463 CDD:275368 5/20 (25%)
ZNF530NP_065931.3 KRAB 14..>55 CDD:214630
KRAB 14..53 CDD:279668
C2H2 Zn finger 213..233 CDD:275368 4/20 (20%)
C2H2 Zn finger 241..261 CDD:275368 7/20 (35%)
COG5048 264..598 CDD:227381 97/232 (42%)
zf-C2H2 267..289 CDD:278523 3/24 (13%)
C2H2 Zn finger 269..289 CDD:275368 2/22 (9%)
zf-H2C2_2 281..306 CDD:290200 8/25 (32%)
C2H2 Zn finger 297..317 CDD:275368 8/20 (40%)
zf-H2C2_2 310..334 CDD:290200 16/24 (67%)
C2H2 Zn finger 325..345 CDD:275368 9/20 (45%)
zf-C2H2 351..373 CDD:278523 11/22 (50%)
C2H2 Zn finger 353..373 CDD:275368 10/20 (50%)
C2H2 Zn finger 381..401 CDD:275368 8/20 (40%)
zf-H2C2_2 397..416 CDD:290200 13/21 (62%)
C2H2 Zn finger 409..429 CDD:275368 9/22 (41%)
zf-H2C2_2 422..446 CDD:290200 12/24 (50%)
C2H2 Zn finger 437..457 CDD:275368 6/20 (30%)
C2H2 Zn finger 465..485 CDD:275368 5/20 (25%)
zf-H2C2_2 477..502 CDD:290200 4/15 (27%)
C2H2 Zn finger 493..513 CDD:275368
zf-H2C2_2 505..530 CDD:290200
C2H2 Zn finger 521..541 CDD:275368
zf-H2C2_2 533..558 CDD:290200
C2H2 Zn finger 549..569 CDD:275368
zf-H2C2_2 561..586 CDD:290200
C2H2 Zn finger 577..597 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.