DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and CG33213

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_788749.1 Gene:CG33213 / 338395 FlyBaseID:FBgn0053213 Length:341 Species:Drosophila melanogaster

Alignment Length:323 Identity:69/324 (21%)
Similarity:105/324 (32%) Gaps:95/324 (29%)


  Fly   146 QQQHESITNAAPTAAP--SAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSA 208
            ::.|..|||...|.:|  |.|:.:...|.|..|:.|:|.:                    ..::.
  Fly    63 KELHAPITNGGATESPKKSVQQKRLNEVTGMFANEAMVPR--------------------RERAI 107

  Fly   209 HTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQC 273
            .|.:.            |...||:     ....:..:..||...||.     ..:.|:.:|.:..
  Fly   108 QTENA------------GTKDAGI-----QCRRDSEEWYLPEERPKD-----TGSEASNSDKFLT 150

  Fly   274 NVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPY----KCDVCGR 334
            .|.:.||..|..::            ||..|..:.......|.|...|     |    .|..||:
  Fly   151 YVSENTFIFPNGMM------------ECAVCGDVAKTLLEHQSHMTAH-----YGPGALCFRCGQ 198

  Fly   335 AFEHSGKLHRHMRIHTGERPHKCS--------VCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCG 391
            ..:|..:|.:|........|.|.|        :|........||:.|:|.|:|.|.|:|.:  |.
  Fly   199 RLDHQKQLKQHSLSCPALAPRKSSMLFKCPHLLCNAMSHSEMQLLRHLRNHSGRKCYRCLQ--CK 261

  Fly   392 KGFTCSKQLKVHS---------------RTHTG-----EKPYHCDICFRDFGYNHVLKLHRVQ 434
            :.|..:..|.||.               |.|.|     ..|..|.:|.:.|....|...||.|
  Fly   262 RYFKTTTSLLVHRKKEQSCAKAKVVVLFREHNGLPNGRGDPRRCSVCLKRFSSERVCLRHRRQ 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 1/20 (5%)
COG5048 <270..420 CDD:227381 41/182 (23%)
zf-C2H2 271..293 CDD:278523 4/22 (18%)
C2H2 Zn finger 273..293 CDD:275368 4/20 (20%)
zf-H2C2_2 286..309 CDD:290200 3/23 (13%)
C2H2 Zn finger 301..321 CDD:275368 4/20 (20%)
zf-H2C2_2 313..338 CDD:290200 7/29 (24%)
C2H2 Zn finger 329..349 CDD:275368 6/20 (30%)
zf-H2C2_2 344..366 CDD:290200 5/30 (17%)
C2H2 Zn finger 357..377 CDD:275368 6/28 (21%)
zf-H2C2_2 370..396 CDD:290200 10/26 (38%)
C2H2 Zn finger 385..407 CDD:275368 7/37 (19%)
zf-H2C2_2 400..424 CDD:290200 10/44 (23%)
C2H2 Zn finger 415..435 CDD:275368 7/21 (33%)
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
CG33213NP_788749.1 C2H2 Zn finger 257..292 CDD:275368 7/37 (19%)
C2H2 Zn finger 305..323 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.