DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and CG17612

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster

Alignment Length:223 Identity:66/224 (29%)
Similarity:98/224 (44%) Gaps:26/224 (12%)


  Fly   259 KPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTH----TGERP-FECEFCHKLFSVKENLQVHR 318
            ||:.....|..|::|..|.|.|.:.|:|..|.|||    |.|.| .:|..|..::..:..|:.|.
  Fly   276 KPVDYEVTGKPPHRCPQCPKIFLLAAKLQAHIRTHNETRTTEPPRLKCPMCPSIYMKRGCLEAHM 340

  Fly   319 RIHTK--------ERPYKCDVCGRAFEHSGKLHRHMRIH-------TGERPHKCSVCEKTFIQSG 368
            .||..        |.||:|..|.:.|.:|..|..|::.|       :.:..|||:.|...|....
  Fly   341 WIHRASDERESELEPPYRCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVS 405

  Fly   369 QLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLH-R 432
            .|..|::.|.||:.:|||.  |...|.....||.|...||   .:.|..|.:.|...:.|..| :
  Fly   406 SLKDHVKIHAGERTFKCPL--CLMSFQEESNLKSHDCAHT---RFKCHKCSKFFESQNYLDFHFK 465

  Fly   433 VQHYGSKCYKCTICDETFKNKKEMEAHI 460
            ..|.....:||..|.:||:.:..::.||
  Fly   466 KSHTTKGPFKCIKCQQTFQKRNGLKEHI 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368
COG5048 <270..420 CDD:227381 52/170 (31%)
zf-C2H2 271..293 CDD:278523 9/22 (41%)
C2H2 Zn finger 273..293 CDD:275368 9/20 (45%)
zf-H2C2_2 286..309 CDD:290200 10/28 (36%)
C2H2 Zn finger 301..321 CDD:275368 5/20 (25%)
zf-H2C2_2 313..338 CDD:290200 10/33 (30%)
C2H2 Zn finger 329..349 CDD:275368 6/20 (30%)
zf-H2C2_2 344..366 CDD:290200 7/29 (24%)
C2H2 Zn finger 357..377 CDD:275368 5/20 (25%)
zf-H2C2_2 370..396 CDD:290200 10/26 (38%)
C2H2 Zn finger 385..407 CDD:275368 7/22 (32%)
zf-H2C2_2 400..424 CDD:290200 8/24 (33%)
C2H2 Zn finger 415..435 CDD:275368 5/21 (24%)
zf-C2H2 441..463 CDD:278523 7/21 (33%)
C2H2 Zn finger 443..463 CDD:275368 6/19 (32%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071
C2H2 Zn finger 290..310 CDD:275368 9/20 (45%)
C2H2 Zn finger 323..343 CDD:275370 5/20 (25%)
zf-C2H2_8 356..438 CDD:292531 26/84 (31%)
C2H2 Zn finger 359..379 CDD:275368 6/20 (30%)
C2H2 Zn finger 394..414 CDD:275368 5/20 (25%)
C2H2 Zn finger 422..438 CDD:275368 6/18 (33%)
C2H2 Zn finger 447..463 CDD:275368 4/16 (25%)
C2H2 Zn finger 476..505 CDD:275368 6/19 (32%)
C2H2 Zn finger 513..533 CDD:275368
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 568..584 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.