DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Zbtb41

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001178599.1 Gene:Zbtb41 / 289052 RGDID:1560834 Length:908 Species:Rattus norvegicus

Alignment Length:722 Identity:163/723 (23%)
Similarity:255/723 (35%) Gaps:245/723 (34%)


  Fly    23 KKSGTELLDISKSPAKAVAVKKSPAKDSATTKMVYYSANQLLIKTEQSSQAQFCLQVPPPLTATT 87
            ||.|.::|:.|.|..::...:|.|.|...|:            ..||.|                
  Rat   238 KKHGLKMLERSFSTRRSKRNRKCPVKFDDTS------------DDEQES---------------- 274

  Fly    88 TSVGLGVPPSGGQQEHFELLQTPQQRQ----MQLQLQDQHQQEQQQFVSYQLAIQQHQKQQQQQQ 148
                 |.......||.|:..::.:...    ....::|:..:|:         :...:...:|..
  Rat   275 -----GDGSDNLNQESFDKERSDRNDSEDPGSDYNVEDEELEEE---------VSDEESDTEQSD 325

  Fly   149 HESITNAAPTAAPSAQRI-----------------------KT-EPVGGFPASAAVVSQVRKPSA 189
            .::.....|.||.||..|                       || :.:|.:.      |..|..:.
  Rat   326 KDNDAEEEPEAADSAGSIHEGLAPVVIQNSNKKILQCPKCDKTFDRIGKYE------SHTRVHTG 384

  Fly   190 SKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLN----------GASGAGVAAPVSTAAIELN 244
            .|| |:||.|...:.:||..|.|.|.||...:....          .||...:|..|.....|  
  Rat   385 EKP-FECDICHQRYSTKSNLTVHRKKHSSEVEFHKKEHKCPYCNKLHASKKTLAKHVKRFHPE-- 446

  Fly   245 DAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLF- 308
            :|...:.|.|:.           ::.::|::|:|:|.....|..|...|:.::||:|.:|.:.| 
  Rat   447 NAQEFISIKKTK-----------SESWKCDICKKSFTRRPHLEEHMILHSQDKPFKCTYCEEHFK 500

  Fly   309 -----------------------------------------------------SVKE--NLQVHR 318
                                                                 ||:|  .|:.|.
  Rat   501 SRFARLKHQEKFHLGPFPCDICGRQFNDTGNLKRHIECTHGGKRKWTCFICGKSVRERTTLKEHL 565

  Fly   319 RIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPY 383
            |||:.|:|:.|.:||::|.|......|:|:|..::.::|..|.||||:...|..|.:.|:|||.:
  Rat   566 RIHSGEKPHLCSICGQSFRHGSSYRLHLRVHHDDKRYECDECGKTFIRHDHLTKHKKIHSGEKAH 630

  Fly   384 KCPEPGCGKGF-------------------------------TCSK------QLKVHSRTHTGEK 411
            :|.|  |||.|                               .|.|      .|::|.|||:|||
  Rat   631 QCEE--CGKCFGRRDHLTVHYKSVHLGEKVWQKYKATFHQCDVCKKIFKGKSSLEMHFRTHSGEK 693

  Fly   412 PYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKG-HANEVPDDEAEAA 475
            ||.|.||.:.|.....|..|.|.|..::.:.|..|:.|||.|.:::.||.. |..:.|||..   
  Rat   694 PYKCQICNQSFRIKKTLTKHLVIHSDARPFNCQHCNATFKRKDKLKYHIDHVHGIKSPDDSL--- 755

  Fly   476 AASAAASTSAGSSAGSPSLQGVSSNSESSNHSPPSSPPATKKPRQAR------QPRV----SKT- 529
                                   |.||....|.|....:..|..||.      ||:|    :|| 
  Rat   756 -----------------------STSEEKLMSLPIEYSSDDKIFQAETKQYLDQPKVYQSEAKTM 797

  Fly   530 ---VAATLSIPTSSPLSPSSLSSTYSPSASSMASPPPTSAHYLPVQME-------ADALSRDSGV 584
               |:|.:.:|.:  |.|..:..|.|...|...:.|.:|...||.|.:       ||....:...
  Rat   798 LQNVSAEVCVPVT--LVPVQMPDTSSDLVSHTTTLPTSSHEMLPPQTQPTDYPRAADLAFLEKYT 860

  Fly   585 SSAQPAH 591
            .:.|||:
  Rat   861 LTPQPAN 867

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 8/20 (40%)
COG5048 <270..420 CDD:227381 63/243 (26%)
zf-C2H2 271..293 CDD:278523 6/22 (27%)
C2H2 Zn finger 273..293 CDD:275368 6/20 (30%)
zf-H2C2_2 286..309 CDD:290200 8/77 (10%)
C2H2 Zn finger 301..321 CDD:275368 10/76 (13%)
zf-H2C2_2 313..338 CDD:290200 11/25 (44%)
C2H2 Zn finger 329..349 CDD:275368 7/20 (35%)
zf-H2C2_2 344..366 CDD:290200 9/22 (41%)
C2H2 Zn finger 357..377 CDD:275368 8/20 (40%)
zf-H2C2_2 370..396 CDD:290200 12/57 (21%)
C2H2 Zn finger 385..407 CDD:275368 12/59 (20%)
zf-H2C2_2 400..424 CDD:290200 14/24 (58%)
C2H2 Zn finger 415..435 CDD:275368 7/20 (35%)
zf-C2H2 441..463 CDD:278523 8/23 (35%)
C2H2 Zn finger 443..463 CDD:275368 8/21 (38%)
Zbtb41NP_001178599.1 BTB 78..174 CDD:279045
BTB 90..174 CDD:197585
C2H2 Zn finger 362..382 CDD:275368 5/26 (19%)
C2H2 Zn finger 390..410 CDD:275368 8/20 (40%)
C2H2 Zn finger 423..441 CDD:275368 4/18 (22%)
C2H2 Zn finger 464..484 CDD:275368 6/20 (30%)
C2H2 Zn finger 492..509 CDD:275368 3/17 (18%)
C2H2 Zn finger 519..540 CDD:275368 0/21 (0%)
C2H2 Zn finger 548..568 CDD:275368 7/20 (35%)
zf-H2C2_2 561..585 CDD:290200 11/24 (46%)
C2H2 Zn finger 576..596 CDD:275368 7/20 (35%)
zf-C2H2 602..624 CDD:278523 8/22 (36%)
C2H2 Zn finger 604..624 CDD:275368 8/20 (40%)
zf-H2C2_2 616..641 CDD:290200 12/27 (44%)
C2H2 Zn finger 632..650 CDD:275368 6/20 (30%)
C2H2 Zn finger 669..686 CDD:275368 4/17 (24%)
zf-H2C2_2 681..704 CDD:290200 13/23 (57%)
C2H2 Zn finger 697..717 CDD:275368 7/20 (35%)
C2H2 Zn finger 725..742 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.