DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and ZNF652

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001138837.1 Gene:ZNF652 / 22834 HGNCID:29147 Length:606 Species:Homo sapiens

Alignment Length:611 Identity:140/612 (23%)
Similarity:231/612 (38%) Gaps:148/612 (24%)


  Fly     9 KSWAPKQIWIKDVLKKSGTELLDISKSP----AKAV----AVKKSPAKDSAT---TKMVYYSANQ 62
            :|.:|..:.:.  .|.|...|.:..:.|    .:||    |||:.......|   .:.|.|...|
Human    54 ESGSPYSVLVD--TKMSKPHLHETEEQPYFRETRAVSDVHAVKEDRENSDDTEEEEEEVSYKREQ 116

  Fly    63 LLIKTEQSSQAQFCLQVPPPLTATTTSVGLGVPPSGGQQEHFELLQTPQQRQMQLQLQDQHQQEQ 127
            ::::...::|              |.:|..|......|.:...:|:|..:.      :::..:|:
Human   117 IIVEVNLNNQ--------------TLNVSKGEKGVSSQSKETPVLKTSSEE------EEEESEEE 161

  Fly   128 QQFVSYQLAIQQHQKQQ----------QQQQHESITNAAPTAAPS-----AQRIKTEPVGGFP-- 175
            ....|......:.||::          |::...:.:.||.|.:|:     .:|...||    |  
Human   162 ATDDSNDYGENEKQKKKEKIVEKVSVTQRRTRRAASVAAATTSPTPRTTRGRRKSVEP----PKR 222

  Fly   176 ---ASAAVVSQVRKPSA-SKPQFKCDQCGMTFGSKSAHTSHTK-SHSKNQ-------------DL 222
               |:....:.|:|... .|....|::|...|.::.....|.. :|.:.|             :|
Human   223 KKRATKEPKAPVQKAKCEEKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKKFVLESEL 287

  Fly   223 SLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAG--ADPYQCNVCQKTFAVPAR 285
            ||:..:.    ...:...:..|.:     ..|..::.....:..|  ...:.|.:|:|.|...|.
Human   288 SLHQQTD----CEKNIQCVSCNKS-----FKKLWSLHEHIKIVHGYAEKKFSCEICEKKFYTMAH 343

  Fly   286 LIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHT 350
            :.:|...||.:.||.||.|.|.|....:|:||...|:.|:|::|:.|...|::..:|..||.||.
Human   344 VRKHMVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSHMSIHI 408

  Fly   351 GERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHC 415
            |.:...|..|.|.|........||:|||||||:.|..  |||.||....:|.|.|||||||||.|
Human   409 GHKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPFICEI--CGKSFTSRPNMKRHRRTHTGEKPYPC 471

  Fly   416 DICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKGHANEVPDDEAEAAAASAA 480
            |:|.:.|.::::||.|:     .||::.|                 ...|..|..:.....:.|.
Human   472 DVCGQRFRFSNMLKAHK-----EKCFRVT-----------------SPVNVPPAVQIPLTTSPAT 514

  Fly   481 ASTSAGSSAGSPSLQGVSSNSESSNHSPPSSPPATKKPRQARQPRVSKTVAATLSIPTSSPLSPS 545
            ...|..::|.:|                  :||....|.....||           |...|.|..
Human   515 PVPSVVNTATTP------------------TPPINMNPVSTLPPR-----------PIPHPFSHL 550

  Fly   546 SLSSTYSPSASSMASPPPTSAHYLPV 571
            .:            .|.|...|:||:
Human   551 HI------------HPHPHHPHHLPI 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/21 (19%)
COG5048 <270..420 CDD:227381 63/150 (42%)
zf-C2H2 271..293 CDD:278523 6/22 (27%)
C2H2 Zn finger 273..293 CDD:275368 6/20 (30%)
zf-H2C2_2 286..309 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 8/20 (40%)
zf-H2C2_2 313..338 CDD:290200 9/25 (36%)
C2H2 Zn finger 329..349 CDD:275368 7/20 (35%)
zf-H2C2_2 344..366 CDD:290200 9/22 (41%)
C2H2 Zn finger 357..377 CDD:275368 7/20 (35%)
zf-H2C2_2 370..396 CDD:290200 15/26 (58%)
C2H2 Zn finger 385..407 CDD:275368 10/22 (45%)
zf-H2C2_2 400..424 CDD:290200 15/24 (63%)
C2H2 Zn finger 415..435 CDD:275368 7/20 (35%)
zf-C2H2 441..463 CDD:278523 1/22 (5%)
C2H2 Zn finger 443..463 CDD:275368 1/20 (5%)
ZNF652NP_001138837.1 UFD1 <240..304 CDD:332114 10/68 (15%)
C2H2 Zn finger 247..266 CDD:275368 4/19 (21%)
C2H2 Zn finger 274..293 CDD:275368 3/19 (16%)
C2H2 Zn finger 301..321 CDD:275368 2/25 (8%)
C2H2 Zn finger 331..351 CDD:275368 6/20 (30%)
C2H2 Zn finger 359..379 CDD:275368 8/20 (40%)
SFP1 <381..464 CDD:227516 35/85 (41%)
C2H2 Zn finger 387..407 CDD:275368 7/20 (35%)
C2H2 Zn finger 415..435 CDD:275368 7/20 (35%)
COG5048 439..>488 CDD:227381 26/51 (51%)
C2H2 Zn finger 443..463 CDD:275368 10/22 (45%)
C2H2 Zn finger 471..487 CDD:275368 6/16 (38%)
Mediates interaction with CBFA2T3. {ECO:0000269|PubMed:16966434} 498..606 19/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.