DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Zfp384

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:XP_006237389.1 Gene:Zfp384 / 171018 RGDID:708346 Length:612 Species:Rattus norvegicus

Alignment Length:570 Identity:150/571 (26%)
Similarity:224/571 (39%) Gaps:151/571 (26%)


  Fly     1 MTESKNDTKSWAPKQIWIKDVLKKSGTELLDISKSPAKAVAVKKSPAKDSATTKMVYYSANQLLI 65
            ||...:.::.|           ::.|::    |:.|...:.   ||:....||..   ||....|
  Rat    99 MTAGVSCSQRW-----------RREGSQ----SRGPGLVIT---SPSGSLVTTAS---SAQTFPI 142

  Fly    66 KTEQ-------SSQAQFCLQVPPPLT----ATTTSVGLG--------VPPSGGQQEHFELLQTPQ 111
            .|..       .|||   |||.|.|:    :|.|..|.|        .||           :.|:
  Rat   143 STPMIVSALPPGSQA---LQVVPDLSKKVASTLTEEGGGGGGGGGTVAPP-----------KPPR 193

  Fly   112 QRQMQLQLQDQHQQEQQQFVSYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPA 176
            .|:.:..|:....:....:|........|||..:..:.|.  |.......|...:.:.|      
  Rat   194 GRKKKRMLESGLPEMNDPYVLAPGDDDDHQKDGKTYRSEG--NCGTGNGQSLGLMDSVP------ 250

  Fly   177 SAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAI 241
             .:..:.:..|.       |..|.:||.|||....|:|||::.:                     
  Rat   251 -GSTTNLLCDPG-------CRMCSLTFYSKSEMQIHSKSHTETK--------------------- 286

  Fly   242 ELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHK 306
                                        |::|..|.||||..:.|.:|.|.|:|.:|:.|.||.|
  Rat   287 ----------------------------PHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNFCEK 323

  Fly   307 LFSVKENLQVHRRIHTKE-----RPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQ 366
            .|....:||.|.|||:|.     :|:||..|.:.|.::..|.:|:|||:|.:|:.||.|:|.|.|
  Rat   324 SFRQLSHLQQHTRIHSKMHTETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQ 388

  Fly   367 SGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDF----GYNHV 427
            ...|..|.|.|||::||||..|||.|.||....|:.|.|.|..:||:.|..|.|.:    .....
  Rat   389 LSHLQQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDKPFKCHNCHRAYTDAASLEAH 453

  Fly   428 LKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKGHANEVPD--DEAEAAAASAA---------- 480
            |..|.|:|  :|.|.||||...:.::..:..|::.|  ..||  .:.:||||:||          
  Rat   454 LSTHTVKH--AKVYTCTICSRAYTSETYLMKHMRKH--NPPDLQQQVQAAAAAAAVAQAQAQAQA 514

  Fly   481 -------ASTSAGSSAGSPSLQGVSSNSESSNHSPPSSPPATKKPRQARQ 523
                   |...|.:.|.:.:....:|..:.....||..||..:.|..|.|
  Rat   515 QAQAQAQAQAQAQAQAQAQAQASQASQQQQQQQPPPPQPPHFQSPGAAPQ 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 10/20 (50%)
COG5048 <270..420 CDD:227381 67/155 (43%)
zf-C2H2 271..293 CDD:278523 9/22 (41%)
C2H2 Zn finger 273..293 CDD:275368 9/20 (45%)
zf-H2C2_2 286..309 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..321 CDD:275368 10/20 (50%)
zf-H2C2_2 313..338 CDD:290200 12/30 (40%)
C2H2 Zn finger 329..349 CDD:275368 7/20 (35%)
zf-H2C2_2 344..366 CDD:290200 11/22 (50%)
C2H2 Zn finger 357..377 CDD:275368 9/20 (45%)
zf-H2C2_2 370..396 CDD:290200 16/26 (62%)
C2H2 Zn finger 385..407 CDD:275368 10/22 (45%)
zf-H2C2_2 400..424 CDD:290200 9/28 (32%)
C2H2 Zn finger 415..435 CDD:275368 6/24 (25%)
zf-C2H2 441..463 CDD:278523 6/22 (27%)
C2H2 Zn finger 443..463 CDD:275368 5/20 (25%)
Zfp384XP_006237389.1 C2H2 Zn finger 262..282 CDD:275368 10/20 (50%)
zf-H2C2_2 274..299 CDD:290200 11/74 (15%)
COG5048 <285..440 CDD:227381 66/204 (32%)
C2H2 Zn finger 290..310 CDD:275368 9/20 (45%)
zf-H2C2_2 302..327 CDD:290200 11/25 (44%)
C2H2 Zn finger 318..338 CDD:275368 10/20 (50%)
C2H2 Zn finger 351..371 CDD:275368 7/20 (35%)
zf-C2H2 377..399 CDD:278523 9/22 (41%)
C2H2 Zn finger 379..399 CDD:275368 9/20 (45%)
zf-H2C2_2 391..418 CDD:290200 16/27 (59%)
C2H2 Zn finger 407..429 CDD:275368 10/22 (45%)
C2H2 Zn finger 437..457 CDD:275368 4/20 (20%)
C2H2 Zn finger 467..487 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.