DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and zfx

DIOPT Version :8

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:XP_002935227.1 Gene:zfx / 100038167 XenbaseID:XB-GENE-479751 Length:793 Species:Xenopus tropicalis

Alignment Length:360 Identity:94/361 (26%)
Similarity:145/361 (40%) Gaps:106/361 (29%)


  Fly   177 SAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAI 241
            :|||:.       ::...:|::||..|...:|..:|..:|.:.....::..         .....
 Frog   466 TAAVIK-------TEKDLECEECGKIFLHANALFAHKLTHKEKAGNKMHRC---------KFCDY 514

  Fly   242 ELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHK 306
            |..:.||        ..:.|..|.:.:.|:.|..|.|.|..|:.|.:|.||||||:|:.|::|..
 Frog   515 ETAEQGL--------LNRHLLAVHSKSFPHICVECGKGFRHPSELKKHMRTHTGEKPYLCQYCDY 571

  Fly   307 LFSVKENLQVH-RRIHTKERPYKCDVCGRAF----------------------------EHSGKL 342
            ..:...||:.| :..|:||.|:|||:|.:.|                            .:|..|
 Frog   572 RSADSSNLKTHVKTKHSKEMPFKCDICLQTFADSKDLQAHAILHQESKSHQCLHCDHKSSNSSDL 636

  Fly   343 HRH-MRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEK------------------------- 381
            .|| :.:||.:.||||.||||.|.:..:|..|...|.|:|                         
 Frog   637 KRHIISVHTKDYPHKCEVCEKGFHRPSELKKHEAAHKGKKMHQCRHCEFQIADPFVLSRHILSVH 701

  Fly   382 ----PYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYN---------HVLKLHRV 433
                |::|..  |.|||....:||.|.:||:|:|.|.|:.|    .||         ||:.:|  
 Frog   702 TKELPFRCKR--CKKGFRQQMELKKHMKTHSGKKVYQCEYC----EYNTTDASGFKRHVISIH-- 758

  Fly   434 QHYGSKCY--KCTICDETFKNKKEMEAHIKGHANE 466
                :|.|  :|..|.:.|:...|...|...|..|
 Frog   759 ----TKDYPHRCDYCKKGFRRPSEKNQHTLKHHKE 789

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 6/20 (30%)
COG5048 <270..420 CDD:227381 65/209 (31%)
zf-C2H2 271..293 CDD:278523 9/22 (41%)
C2H2 Zn finger 273..293 CDD:275368 9/20 (45%)
zf-H2C2_2 286..309 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..321 CDD:275368 5/21 (24%)
zf-H2C2_2 313..338 CDD:290200 12/54 (22%)
C2H2 Zn finger 329..349 CDD:275368 8/49 (16%)
zf-H2C2_2 344..366 CDD:290200 13/23 (57%)
C2H2 Zn finger 357..377 CDD:275368 8/20 (40%)
zf-H2C2_2 370..396 CDD:290200 11/55 (20%)
C2H2 Zn finger 385..407 CDD:275368 9/22 (41%)
zf-H2C2_2 400..424 CDD:290200 10/24 (42%)
C2H2 Zn finger 415..435 CDD:275368 7/29 (24%)
zf-C2H2 441..463 CDD:278523 6/24 (25%)
C2H2 Zn finger 443..463 CDD:275368 5/20 (25%)
zfxXP_002935227.1 Zfx_Zfy_act 71..395 CDD:282547
C2H2 Zn finger 412..435 CDD:275368
ROS_MUCR <412..>428 CDD:303058
C2H2 Zn finger 443..463 CDD:275368
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 509..530 CDD:275368 5/38 (13%)
COG5048 534..>789 CDD:227381 78/267 (29%)
zf-C2H2 536..558 CDD:278523 9/22 (41%)
C2H2 Zn finger 538..558 CDD:275368 9/20 (45%)
zf-H2C2_2 550..572 CDD:290200 11/22 (50%)
C2H2 Zn finger 566..587 CDD:275368 5/21 (24%)
C2H2 Zn finger 595..615 CDD:275368 4/20 (20%)
C2H2 Zn finger 623..644 CDD:275368 4/21 (19%)
C2H2 Zn finger 652..701 CDD:275368 11/49 (22%)
zf-C2H2 707..729 CDD:278523 9/24 (38%)
C2H2 Zn finger 709..729 CDD:275368 9/22 (41%)
zf-H2C2_2 721..742 CDD:290200 10/25 (40%)
C2H2 Zn finger 737..758 CDD:275368 6/25 (24%)
C2H2 Zn finger 766..786 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.