DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12393 and BOI1

Sequence 1:NP_001137795.2 Gene:CG12393 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_009468.1 Gene:BOI1 SGDID:S000000181 Length:980 Species:Saccharomyces cerevisiae

Alignment Length:182 Identity:42/183 (23%)
Similarity:71/183 (39%) Gaps:51/183 (28%)


  Fly    18 DMEGFLNKRGE-VNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEGCTIELSNEVD------- 74
            |..|:::|:|. ....:::|:|.|.|..|.||.:..|::..|||.:....:..:::.|       
Yeast   778 DCSGWMSKKGTGAMGTWKQRFFTLHGTRLSYFTNTNDEKERGLIDITAHRVLPASDDDRLISLYA 842

  Fly    75 ------NYCFE-----------IAFNGNRTYILAAENQDSMETWMKAL------------TCAGY 110
                  .|||:           :.|...|.:..|.||:..|:.|:.|:            ..:.|
Yeast   843 ASLGKGKYCFKLVPPQPGSKKGLTFTEPRVHYFAVENKSEMKAWLSAIIKATIDIDTSVPVISSY 907

  Fly   111 EYKRIIL---------AELKRQLQ--EMEDARNKMLGSALDGPQNASESAKP 151
            ....|.|         |.|:.||:  |.|:.|::.   ..|..||...|..|
Yeast   908 ATPTIPLSKAQTLLEEARLQTQLRDAEEEEGRDQF---GWDDTQNKRNSNYP 956

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12393NP_001137795.2 PH_Ses 11..127 CDD:270105 35/157 (22%)
PH 19..105 CDD:278594 26/111 (23%)
BOI1NP_009468.1 SH3_BOI 17..71 CDD:212819
SAM_superfamily 226..290 CDD:326639
PH_Boi 778..894 CDD:270126 27/116 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22902
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.