| Sequence 1: | NP_001137795.2 | Gene: | IPIP / 33849 | FlyBaseID: | FBgn0031768 | Length: | 296 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_692142.2 | Gene: | def6c / 563690 | ZFINID: | ZDB-GENE-060503-87 | Length: | 620 | Species: | Danio rerio | 
| Alignment Length: | 276 | Identity: | 53/276 - (19%) | 
|---|---|---|---|
| Similarity: | 94/276 - (34%) | Gaps: | 89/276 - (32%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    20 EGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEGCTI--ELSNEVDNYCFEIAF 82 
  Fly    83 NGNRTYILAAENQDSMETWMKALTCAGYEYKRIILAELKRQL-QEMEDARNKMLGSALDGPQNAS 146 
  Fly   147 ESAKPRPPPRRTNPFNRPAPPPPDSSLRGGVVMSPLPFINGYFGSSNARLQQEKLMSKQDANGNG 211 
  Fly   212 SPSGTPRAQRRPTPAPAIANSVFYPDVRDPGAANNNHSTVNGAERQRRQV--KALEEFARNHER- 273 
  Fly   274 --FRRELMPDVSAYRE 287 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| IPIP | NP_001137795.2 | PH_Ses | 11..127 | CDD:270105 | 33/109 (30%) | 
| PH | 19..105 | CDD:278594 | 26/86 (30%) | ||
| def6c | XP_692142.2 | PH_SWAP-70 | 206..315 | CDD:270092 | 30/103 (29%) | 
| PH | 213..306 | CDD:278594 | 27/89 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||