DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12393 and zgc:153733

Sequence 1:NP_001137795.2 Gene:CG12393 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001038864.1 Gene:zgc:153733 ZFINID:ZDB-GENE-060825-273 Length:282 Species:Danio rerio

Alignment Length:313 Identity:90/314 (29%)
Similarity:132/314 (42%) Gaps:92/314 (29%)


  Fly     1 MKINEKNL-YVFARTPPFDMEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEG 64
            |||::|.| :..:.|.|.|.||:|.|:.|.|..:.||:||||||||||.|...|:..||:|::||
Zfish     1 MKIHKKILTHYLSCTSPVDKEGYLYKKRERNTTYLRRWFVLKGNLLFYQERPGDRNLLGVIVLEG 65

  Fly    65 CTIELSNEVDNYCFEIAFNGN--RTYILAAENQDSMETWMKALTCAGYEYKRIILAELKR----- 122
            |.::.......:||.:.|.|.  |||.|||::..|.|:|:.||.||.:.|..:|:.:|:|     
Zfish    66 CMVQACETDGQFCFSLVFTGPGLRTYRLAADDHPSQESWIAALFCASHIYLSMIVRDLERRYEEA 130

  Fly   123 ----------QLQEMEDARNKMLGS---------------ALDGPQNASESAKPRPPPRRTNPFN 162
                      |..|:..|.|.::.|               ..||...::.|..|...|.|.:.|:
Zfish   131 KRDKGLCVSIQTSEVTSAPNTIMASWYTGQPYFIQGTSIVPRDGRSYSTSSIAPTYVPNRPSNFS 195

  Fly   163 RPAPPPPDSSLRGGVVMSPLPFINGYFGSSNARLQQEKLMSKQDANGNGSPSGTPRAQRRPTP-- 225
            ..|||                   ..|.::|.|                ||...|:.....||  
Zfish   196 LHAPP-------------------AQFKATNKR----------------SPKLWPKRNAHVTPLN 225

  Fly   226 APAIANSVFYPDVRDPGAANNNHSTVNGAERQRRQVKALEEFARNHERFRREL 278
            .||.::|.:.....||                      ||||::.||.:..|:
Zfish   226 GPAPSHSEWPMMGFDP----------------------LEEFSKLHEHYGNEV 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12393NP_001137795.2 PH_Ses 11..127 CDD:270105 52/133 (39%)
PH 19..105 CDD:278594 40/88 (45%)
zgc:153733NP_001038864.1 PH_Ses 11..130 CDD:270105 50/119 (42%)
PH 18..108 CDD:278594 41/90 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CH2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001059
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22902
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.