powered by:
                   
 
    
    
             
          
            Protein Alignment IPIP and Y37D8A.25
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001137795.2 | Gene: | IPIP / 33849 | FlyBaseID: | FBgn0031768 | Length: | 296 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001022833.1 | Gene: | Y37D8A.25 / 3565405 | WormBaseID: | WBGene00012560 | Length: | 141 | Species: | Caenorhabditis elegans | 
        
        
        
          
            | Alignment Length: | 139 | Identity: | 40/139 - (28%) | 
          
            | Similarity: | 68/139 -  (48%) | Gaps: | 15/139 - (10%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     1 MKINEKNLYVFARTPPFD--MEGFLNKRGEVNKAFQRR--YFVLKGNLLFYF---ESRLDKEPLG 58|..|..:|:.....|.|:  ..|.|    ::.:.||.|  :.|||.|:||.:   |......|..
 Worm     1 MLANANSLFRLGSDPTFERRFSGPL----QLQQDFQWRAGWGVLKANMLFVYNKTEEETSAPPFL 61
 
 
  Fly    59 LIIVEGCTIELSNE---VDNYCFEIAFNGN-RTYILAAENQDSMETWMKALTCAGYEYKRIILAE 119|:|:|.|.|||.:|   ..::.|||.|... |::|.||::..|:..|:..||.:..:|.::....
 Worm    62 LLIIEDCFIELCDENKIGKDFTFEIKFKSTARSFIFAADSFKSLGRWVSLLTISPIDYIQLSKQS 126
 
 
  Fly   120 LKRQLQEME 128...|:::.:
 Worm   127 FHEQIEQTQ 135
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I8444 | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0003195 | 
          
            | OrthoInspector | 1 | 1.000 | - | - |  | oto18137 | 
          
            | orthoMCL | 1 | 0.900 | - | - |  | OOG6_106541 | 
          
            | Panther | 1 | 1.100 | - | - | LDO | PTHR22902 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4038 | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 7 | 6.940 |  | 
        
      
           
             Return to query results.
             Submit another query.