DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12393 and Y37D8A.25

Sequence 1:NP_001137795.2 Gene:CG12393 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001022833.1 Gene:Y37D8A.25 WormBaseID:WBGene00012560 Length:141 Species:Caenorhabditis elegans

Alignment Length:139 Identity:40/140 (29%)
Similarity:68/140 (49%) Gaps:15/140 (11%)


  Fly     1 MKINEKNLYVFARTPPFD--MEGFLNKRGEVNKAFQRR--YFVLKGNLLFYF---ESRLDKEPLG 58
            |..|..:|:.....|.|:  ..|.|    ::.:.||.|  :.|||.|:||.:   |......|..
 Worm     1 MLANANSLFRLGSDPTFERRFSGPL----QLQQDFQWRAGWGVLKANMLFVYNKTEEETSAPPFL 61

  Fly    59 LIIVEGCTIELSNE---VDNYCFEIAFNGN-RTYILAAENQDSMETWMKALTCAGYEYKRIILAE 119
            |:|:|.|.|||.:|   ..::.|||.|... |::|.||::..|:..|:..||.:..:|.::....
 Worm    62 LLIIEDCFIELCDENKIGKDFTFEIKFKSTARSFIFAADSFKSLGRWVSLLTISPIDYIQLSKQS 126

  Fly   120 LKRQLQEME 128
            ...|:::.:
 Worm   127 FHEQIEQTQ 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12393NP_001137795.2 PH_Ses 11..127 CDD:270105 37/127 (29%)
PH 19..105 CDD:278594 31/95 (33%)
Y37D8A.25NP_001022833.1 PH-like 31..133 CDD:302622 33/102 (32%)
PH 31..112 CDD:278594 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CH2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001059
OrthoInspector 1 1.000 T477458
orthoMCL 1 0.900 OOG5_133636
Panther 1 1.100 LDO PTHR22902
Phylome 1 0.910 0.733 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4038
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.