DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12393 and PHETA2

Sequence 1:NP_001137795.2 Gene:CG12393 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001002034.2 Gene:PHETA2 HGNCID:27161 Length:259 Species:Homo sapiens

Alignment Length:168 Identity:62/169 (37%)
Similarity:95/169 (56%) Gaps:14/169 (8%)


  Fly     1 MKINEKNLYVFART-PPFDMEGFLNKRG------EVNKAFQRRYFVLKGNLLFYFESRLDKEPLG 58
            ||:||:::..:|.: .|.|..|||...|      ..:...:|.:|||||||||.||||..:.||.
Human     1 MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREGRAPLS 65

  Fly    59 LIIVEGCTIELSNE--VDNYCFEIAFN--GNRTYILAAENQDSMETWMKALTCAGYEYKRIILAE 119
            |:::||||:||:..  .:.:.|.|.|:  |.|.::||||...:.|.|:|.|:.|.:.|.|:::.|
Human    66 LVVLEGCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRASFGYMRLVVRE 130

  Fly   120 LKRQLQEMEDARNKMLGSALDGPQNASESAKPRPPPRR 157
            |:.|||   |||..:........::.:...||:.|..|
Human   131 LESQLQ---DARQSLALQRRSSWKSVASRCKPQAPNHR 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12393NP_001137795.2 PH_Ses 11..127 CDD:270105 51/127 (40%)
PH 19..105 CDD:278594 39/96 (41%)
PHETA2NP_001002034.2 PH-like 11..138 CDD:327399 52/130 (40%)
F&H 223..235
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CH2W
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001059
OrthoInspector 1 1.000 T609921
orthoMCL 1 0.900 OOG5_133636
Panther 1 1.100 LDO PTHR22902
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.