DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12393 and PHETA1

Sequence 1:NP_001137795.2 Gene:CG12393 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001171467.1 Gene:PHETA1 HGNCID:26509 Length:262 Species:Homo sapiens

Alignment Length:297 Identity:101/298 (34%)
Similarity:146/298 (49%) Gaps:62/298 (21%)


  Fly     1 MKINEKNLYVFAR-TPPFDMEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEG 64
            ||:||::|..:|. ..|.|..|||.|:|..:.|:.||:|||:||:|||||....:||:|:||:||
Human    14 MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEG 78

  Fly    65 CTIELSNEVDNYCFEIAFNGN--RTYILAAENQDSMETWMKALTCAGYEYKRIILAELKRQLQEM 127
            ||:||....:.:.|.:.|.|.  |||:||||:||:||.|:|||:.|.::|.|:::.||::||..:
Human    79 CTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAV 143

  Fly   128 EDARNKMLGSALDGPQNASESAKPRPP--PRRTNPF-NRPAPPPPDSSLRGGVVMSPLPFINGYF 189
            ....    |.||..||..|   .|.||  |....|. :.|:.|.|..:|       |||      
Human   144 RGGG----GMALPQPQPQS---LPLPPSLPSALAPVPSLPSAPAPVPAL-------PLP------ 188

  Fly   190 GSSNARLQQEKLMSKQDANGNGSPSGTPRAQRRPTPAPAIANSVFYPDVRDPGAANNNHSTVNGA 254
                  .:...|..|:    ||....:..|..||.|.|        |.......|:..|..::  
Human   189 ------RRPSALPPKE----NGCAVWSTEATFRPGPEP--------PPPPPRRRASAPHGPLD-- 233

  Fly   255 ERQRRQVKALEEFARNHERFRRELMPDVSAYRERQGQ 291
                     :..|||.||.:.:|:       |..:||
Human   234 ---------MAPFARLHECYGQEI-------RALRGQ 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12393NP_001137795.2 PH_Ses 11..127 CDD:270105 57/119 (48%)
PH 19..105 CDD:278594 46/88 (52%)
PHETA1NP_001171467.1 PH_Ses 24..143 CDD:270105 57/119 (48%)
PH 35..125 CDD:278594 48/90 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CH2W
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001059
OrthoInspector 1 1.000 T609921
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22902
Phylome 1 0.910 0.694 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.