DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12393 and LOC110440083

Sequence 1:NP_001137795.2 Gene:CG12393 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_021335176.1 Gene:LOC110440083 ID: Length:124 Species:Danio rerio

Alignment Length:95 Identity:29/96 (30%)
Similarity:47/96 (49%) Gaps:12/96 (13%)


  Fly    16 PFDMEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEGC--TIELSN---EVDN 75
            |...:|:|.|.....|.:|||:|||...||.|:.::.:       :...|  ||.|:.   ||.:
Zfish    20 PDTYKGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAE-------MAHTCRGTITLATVHIEVGD 77

  Fly    76 YCFEIAFNGNRTYILAAENQDSMETWMKAL 105
            .|..:..:|.|:|.|.|.::...:.|:.||
Zfish    78 TCHFVLTSGGRSYHLKAYSEGECQRWVSAL 107

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12393NP_001137795.2 PH_Ses 11..127 CDD:270105 29/96 (30%)
PH 19..105 CDD:278594 27/91 (30%)
LOC110440083XP_021335176.1 PH_OSBP_ORP4 23..118 CDD:270101 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001059
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.