DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12393 and LOC100486185

Sequence 1:NP_001137795.2 Gene:CG12393 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_002936685.1 Gene:LOC100486185 XenbaseID:XB-GENE-5957063 Length:310 Species:Xenopus tropicalis

Alignment Length:313 Identity:74/314 (24%)
Similarity:111/314 (35%) Gaps:82/314 (26%)


  Fly     8 LYVFARTPP-----FDMEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLD--KEPLGLIIVEGC 65
            |||..|...     ..|||.|.|.......::.|||||...:|.|::|..|  |...|.|.:..|
 Frog    36 LYVCKRLRACERQFLQMEGLLLKWTNYLSGWKPRYFVLDSGILSYYDSPEDVGKVSKGSIKMAVC 100

  Fly    66 TIELSNEVDNYCFEIAFNGNRTYILAAENQDSMETWMKAL----TCAG----------------- 109
            .|.: |..||...::.....:.:.|.|||....:.|:.||    .|.|                 
 Frog   101 EIRV-NPSDNSRMDLIIPNEQYFYLRAENAAERQKWLVALGSAKACIGDSATERPKEDLSGSETL 164

  Fly   110 ---YEYKRIILAELKRQLQEMEDARNKMLGSALDGPQNASESAKPRPPPRRTNPFNRPAPPPPDS 171
               ....|:....|.:|::||:.|.:.      |||..:.:..|.|               ....
 Frog   165 GRKLSELRVFCNFLMQQIKEMQGAVDP------DGPGASPDIEKVR---------------AACC 208

  Fly   172 SLRG--GVVMSPLPFINGYFGSSNARLQQEKLMSKQDANGNGSPSG--TPRAQRRPTPAPAIANS 232
            :|.|  ..:.|.|.....:..::...:.|||....       :|:|  .||||:.       .|:
 Frog   209 ALYGTCSHISSSLEDCMNHISTTQDGIAQEKPPPV-------TPAGIKLPRAQKE-------KNA 259

  Fly   233 VFYPDVRDPGAANNNHSTVNGAERQRRQVKA---LEEFARN-HERFRRELMPD 281
            |....:|.|.:...       |.||..:|..   ||:.||. ..|....|:|:
 Frog   260 VNTSPMRTPQSDYE-------APRQVDEVTVLWKLEDMARRPRARGNEGLLPN 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12393NP_001137795.2 PH_Ses 11..127 CDD:270105 36/147 (24%)
PH 19..105 CDD:278594 28/88 (32%)
LOC100486185XP_002936685.1 PH 50..144 CDD:278594 29/95 (31%)
PH_FAPP1_FAPP2 52..151 CDD:269951 31/100 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001059
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.