DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13996 and Samd15

Sequence 1:NP_608980.1 Gene:CG13996 FlyBaseID:FBgn0031763 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006240460.1 Gene:Samd15 RGDID:1589368 Length:574 Species:Rattus norvegicus

Alignment Length:249 Identity:51/250 (20%)
Similarity:80/250 (32%) Gaps:102/250 (41%)


  Fly    17 PHSASGMDSPDICEPPQDEQEFCFRYPSYMFPDVE--YDKEDVPLPFK----------------- 62
            |...:.:|.|:..|..|..:: ..:.||...|..|  :.|||.|.|.|                 
  Rat   274 PPQTTDLDIPEKSELEQTIEK-SLKLPSEPKPGEEGQFPKEDRPGPSKLKYPIGKDDLIFSEYQK 337

  Fly    63 ----------------ASP---------------------DSLFNLCAAVVDSQARTEV------ 84
                            .||                     |.:..|..||.|.:|.||:      
  Rat   338 KLSEKKSTKSKNDYVVGSPRESVESAGSVYETQEFLRDLQDDMNELFTAVPDLEASTELRDSLVF 402

  Fly    85 ------------------------FKWSINDVTDWLRNFGYPEYEQTFRENYIDGHKLLNLDAVA 125
                                    ..||...|.:|:.:.|||:|::.|.||:|.|.||::::...
  Rat   403 PQDVDILGGKESQINPSLRPQFEHLTWSPERVAEWISDLGYPQYKECFTENFISGQKLIHVNCSN 467

  Fly   126 LVALNVRNFEHIRHLGRGIRAL---------------YRKELQTATETKQQSEV 164
            |..:.:.:||.::.:...:|.|               ||..:....|.|..|.|
  Rat   468 LPQMGITDFEDMKAISYHVRVLLGIEEPLFSRSICLPYRDNIGLFLERKGHSGV 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13996NP_608980.1 SAM_superfamily 85..151 CDD:301707 22/81 (27%)
SAM 86..147 CDD:197735 19/61 (31%)
Samd15XP_006240460.1 SAM_Samd14 427..493 CDD:188929 20/66 (30%)
SAM 428..490 CDD:197735 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMVG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.