DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13996 and CG15625

Sequence 1:NP_608980.1 Gene:CG13996 FlyBaseID:FBgn0031763 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_608872.1 Gene:CG15625 FlyBaseID:FBgn0031644 Length:349 Species:Drosophila melanogaster

Alignment Length:200 Identity:74/200 (37%)
Similarity:119/200 (60%) Gaps:5/200 (3%)


  Fly    51 EYDKEDVPLPFKASPDSLFNLCAAVVDSQARTEVFKWSINDVTDWLRNFGYPEYEQTFRENYIDG 115
            :||.:|:|:.|:.:||||..|...|||......:|:|...|:..|:..:|||:|..|||.|.|.|
  Fly    43 KYDGDDIPIQFRTTPDSLVELSIIVVDKLPLPSIFEWDDMDIRRWINGYGYPQYMNTFRVNMITG 107

  Fly   116 HKLLNLDAVALVALNVRNFEHIRHLGRGIRALYRKELQTATET-----KQQSEVYKTFRARTGRR 175
            .|||.|||.||.|:|::||:||||:..|||.|:..||...:.:     ::.:|:|..|..:||..
  Fly   108 RKLLLLDASALCAMNIKNFDHIRHISYGIRMLFHFELTKFSSSISLPDEKPNELYLLFHTQTGVN 172

  Fly   176 YEGLRETELLGRMHMIRSVFRDVNDWDLMELHMSRAPVRRYREIVAGSRRYNLYGPSTARREPII 240
            |:.:|.::|..||.|:|...|:::.|||:.|.:.....|:|:|::....|:.:|....|.:.|..
  Fly   173 YDEVRRSDLYRRMQMLRERARNLDHWDLLYLWLRHEQERKYKELIGMVPRFTMYKCEEAAKPPEE 237

  Fly   241 TDDVD 245
            .:|::
  Fly   238 PEDME 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13996NP_608980.1 SAM_superfamily 85..151 CDD:301707 34/66 (52%)
SAM 86..147 CDD:197735 32/61 (52%)
CG15625NP_608872.1 SAM_Samd14 77..143 CDD:188929 34/66 (52%)
SAM 78..139 CDD:197735 32/61 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134672679
eggNOG 1 0.900 E1_2CMVG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008070
orthoMCL 1 0.900 OOG5_137051
Panther 1 1.100 P PTHR12573
RoundUp 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.