DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13996 and CG15625

DIOPT Version :9

Sequence 1:NP_608980.1 Gene:CG13996 / 33842 FlyBaseID:FBgn0031763 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_608872.1 Gene:CG15625 / 33694 FlyBaseID:FBgn0031644 Length:349 Species:Drosophila melanogaster


Alignment Length:200 Identity:74/200 - (37%)
Similarity:119/200 - (59%) Gaps:5/200 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EYDKEDVPLPFKASPDSLFNLCAAVVDSQARTEVFKWSINDVTDWLRNFGYPEYEQTFRENYIDG 115
            :||.:|:|:.|:.:||||..|...|||......:|:|...|:..|:..:|||:|..|||.|.|.|
  Fly    43 KYDGDDIPIQFRTTPDSLVELSIIVVDKLPLPSIFEWDDMDIRRWINGYGYPQYMNTFRVNMITG 107

  Fly   116 HKLLNLDAVALVALNVRNFEHIRHLGRGIRALYRKELQTATET-----KQQSEVYKTFRARTGRR 175
            .|||.|||.||.|:|::||:||||:..|||.|:..||...:.:     ::.:|:|..|..:||..
  Fly   108 RKLLLLDASALCAMNIKNFDHIRHISYGIRMLFHFELTKFSSSISLPDEKPNELYLLFHTQTGVN 172

  Fly   176 YEGLRETELLGRMHMIRSVFRDVNDWDLMELHMSRAPVRRYREIVAGSRRYNLYGPSTARREPII 240
            |:.:|.::|..||.|:|...|:::.|||:.|.:.....|:|:|::....|:.:|....|.:.|..
  Fly   173 YDEVRRSDLYRRMQMLRERARNLDHWDLLYLWLRHEQERKYKELIGMVPRFTMYKCEEAAKPPEE 237

  Fly   241 TDDVD 245
            .:|::
  Fly   238 PEDME 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13996NP_608980.1 SAM_superfamily 85..151 CDD:301707 34/65 (52%)
SAM 86..147 CDD:197735 32/60 (53%)
CG15625NP_608872.1 SAM_Samd14 77..143 CDD:188929 34/65 (52%)
SAM 78..139 CDD:197735 32/60 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445027
Domainoid 1 1.000 52 1.000 Domainoid score I11485
eggNOG 1 0.900 - - E1_2CMVG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009897
OrthoInspector 1 1.000 - - otm42537
orthoMCL 1 0.900 - - OOG6_109459
Panther 1 1.100 - - P PTHR12573
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.