| Sequence 1: | NP_608980.1 | Gene: | CG13996 / 33842 | FlyBaseID: | FBgn0031763 | Length: | 256 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001277217.1 | Gene: | Samd15 / 238333 | MGIID: | 2685109 | Length: | 620 | Species: | Mus musculus |
| Alignment Length: | 196 | Identity: | 43/196 - (21%) |
|---|---|---|---|
| Similarity: | 71/196 - (36%) | Gaps: | 74/196 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 26 PDICEPPQDE-QEFCFRYPSYMFPDVEYD--KEDVP---------------LPFKASPDSL---- 68
Fly 69 -----------------------FNLCAAVVD-SQARTEV------------------------- 84
Fly 85 ---FKWSINDVTDWLRNFGYPEYEQTFRENYIDGHKLLNLDAVALVALNVRNFEHIRHLGRGIRA 146
Fly 147 L 147 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13996 | NP_608980.1 | SAM_superfamily | 85..151 | CDD:301707 | 19/63 (30%) |
| SAM | 86..147 | CDD:197735 | 18/60 (30%) | ||
| Samd15 | NP_001277217.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..394 | 15/48 (31%) | |
| SAM_Samd14 | 478..544 | CDD:188929 | 19/63 (30%) | ||
| SAM | 479..533 | CDD:197735 | 17/53 (32%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 594..620 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 50 | 1.000 | Domainoid score | I11607 |
| eggNOG | 1 | 0.900 | - | - | E1_2CMVG | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0009897 | |
| OrthoInspector | 1 | 1.000 | - | - | otm42537 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_109459 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.800 | |||||