DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13996 and Samd15

DIOPT Version :9

Sequence 1:NP_608980.1 Gene:CG13996 / 33842 FlyBaseID:FBgn0031763 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001277217.1 Gene:Samd15 / 238333 MGIID:2685109 Length:620 Species:Mus musculus


Alignment Length:196 Identity:43/196 - (21%)
Similarity:71/196 - (36%) Gaps:74/196 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PDICEPPQDE-QEFCFRYPSYMFPDVEYD--KEDVP---------------LPFKASPDSL---- 68
            |||.|..|.| .|.....|:...|:.|.|  |||.|               ||.|...:.:    
Mouse   345 PDIQEKSQPEPTEKNLELPNKPKPEEERDLPKEDKPESSKPNYPAGKDKLALPAKIKTEFIVGSP 409

  Fly    69 -----------------------FNLCAAVVD-SQARTEV------------------------- 84
                                   .|....:|| |:::||:                         
Mouse   410 RESVESFSTLYETQEFLKDLQTDMNELFPIVDASESQTELRDSTVLPQEVELLGRKETKPSLTPE 474

  Fly    85 ---FKWSINDVTDWLRNFGYPEYEQTFRENYIDGHKLLNLDAVALVALNVRNFEHIRHLGRGIRA 146
               ..||...|.:|:.:.|:|:|::.|.||:|:|.||::::...|..:.:.:||.::.:....|.
Mouse   475 FEHLTWSPERVAEWISDLGFPQYKECFTENFINGQKLIHVNCSNLPQMGITDFEDMKAISYHTRV 539

  Fly   147 L 147
            |
Mouse   540 L 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13996NP_608980.1 SAM_superfamily 85..151 CDD:301707 19/63 (30%)
SAM 86..147 CDD:197735 18/60 (30%)
Samd15NP_001277217.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..394 15/48 (31%)
SAM_Samd14 478..544 CDD:188929 19/63 (30%)
SAM 479..533 CDD:197735 17/53 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..620
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11607
eggNOG 1 0.900 - - E1_2CMVG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009897
OrthoInspector 1 1.000 - - otm42537
orthoMCL 1 0.900 - - OOG6_109459
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.