DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13996 and Samd15

Sequence 1:NP_608980.1 Gene:CG13996 FlyBaseID:FBgn0031763 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017170549.1 Gene:Samd15 MGIID:2685109 Length:694 Species:Mus musculus

Alignment Length:196 Identity:43/197 (22%)
Similarity:71/197 (36%) Gaps:74/197 (38%)


  Fly    26 PDICEPPQDE-QEFCFRYPSYMFPDVEYD--KEDVP---------------LPFKASPDSL---- 68
            |||.|..|.| .|.....|:...|:.|.|  |||.|               ||.|...:.:    
Mouse   345 PDIQEKSQPEPTEKNLELPNKPKPEEERDLPKEDKPESSKPNYPAGKDKLALPAKIKTEFIVGSP 409

  Fly    69 -----------------------FNLCAAVVD-SQARTEV------------------------- 84
                                   .|....:|| |:::||:                         
Mouse   410 RESVESFSTLYETQEFLKDLQTDMNELFPIVDASESQTELRDSTVLPQEVELLGRKETKPSLTPE 474

  Fly    85 ---FKWSINDVTDWLRNFGYPEYEQTFRENYIDGHKLLNLDAVALVALNVRNFEHIRHLGRGIRA 146
               ..||...|.:|:.:.|:|:|::.|.||:|:|.||::::...|..:.:.:||.::.:....|.
Mouse   475 FEHLTWSPERVAEWISDLGFPQYKECFTENFINGQKLIHVNCSNLPQMGITDFEDMKAISYHTRV 539

  Fly   147 L 147
            |
Mouse   540 L 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13996NP_608980.1 SAM_superfamily 85..151 CDD:301707 19/64 (30%)
SAM 86..147 CDD:197735 18/61 (30%)
Samd15XP_017170549.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMVG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008070
OrthoInspector 1 1.000 T616732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.