DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13996 and SAMD15

DIOPT Version :9

Sequence 1:NP_608980.1 Gene:CG13996 / 33842 FlyBaseID:FBgn0031763 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001010860.1 Gene:SAMD15 / 161394 HGNCID:18631 Length:674 Species:Homo sapiens


Alignment Length:279 Identity:50/279 - (17%)
Similarity:90/279 - (32%) Gaps:109/279 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPLPHSASGMDSPDICEPPQDEQ------EFCFRYPSYMFP---DVEYDKEDVPLPFKA------ 63
            :|.|...:|...|....|..:|:      |.....|....|   .||:.|||.|.|.|:      
Human   372 NPQPPEETGPVLPQEINPQVEEKTQTKPTEKILELPDETKPRETHVEFSKEDRPEPIKSKYSVGN 436

  Fly    64 -------------------------------SPDS-------------LFNL---CAAVVDSQAR 81
                                           |.:|             |.|:   |:....|:::
Human   437 DELEHREPKRGKLSLSDKFRKEYYALGSLRESEESIGTHYEFLQPLQKLLNVSEECSYSDPSESQ 501

  Fly    82 TEV--------------------------------------FKWSINDVTDWLRNFGYPEYEQTF 108
            ||:                                      ..|...:|.:|:...|:|:|::.|
Human   502 TELSEFVHEKEVVDLSQELKERVSEDDETQPEKGTELQFEHLNWDPEEVAEWISQLGFPQYKECF 566

  Fly   109 RENYIDGHKLLNLDAVALVALNVRNFEHIRHLGRGIRALYRKELQTATETKQQSEVYKTF----- 168
            ..|:|.|.||::::...|..:.:.|||.::.:.|..:.|.  |::.....:..|..|:..     
Human   567 ITNFISGRKLIHVNCSNLPQMGITNFEDMKAISRHTQELL--EIEEPLFKRSISLPYRDIIGLYL 629

  Fly   169 --RARTGRRYEGLRETELL 185
              :..||.:.:.|..:|.:
Human   630 EQKGHTGIKSDSLTLSEFV 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13996NP_608980.1 SAM_superfamily 85..151 CDD:301707 18/65 (28%)
SAM 86..147 CDD:197735 17/60 (28%)
SAMD15NP_001010860.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..448 17/75 (23%)
ftsN 137..>310 CDD:274041
SAM_Samd14 543..609 CDD:188929 19/67 (28%)
SAM 544..607 CDD:197735 18/64 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11485
eggNOG 1 0.900 - - E1_2CMVG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009897
OrthoInspector 1 1.000 - - otm40460
orthoMCL 1 0.900 - - OOG6_109459
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.