DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13996 and samd15

Sequence 1:NP_608980.1 Gene:CG13996 FlyBaseID:FBgn0031763 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_002938914.2 Gene:samd15 ID: Length:132 Species:Xenopus tropicalis

Alignment Length:118 Identity:34/119 (29%)
Similarity:53/119 (45%) Gaps:25/119 (21%)


  Fly    79 QARTEVFKWSINDVTDWLRNFGYPEYEQTFRENYIDGHKLLNLDAVALVALNVRNFEHIRHLGRG 143
            |...:..:||..:|..|||..|:|:||..|.:|||.|.||::::...|..:.|.:|:|::.:.|.
 Frog    16 QRGPDCLRWSCREVGGWLRFKGFPQYEACFTQNYISGRKLIHVNCSTLPQIGVTDFQHMKEISRL 80

  Fly   144 IRAL-----------------------YRKELQTATETKQQSEVYKTFRARTG 173
            ||.|                       ..|:.||...|  :|..|..|..:.|
 Frog    81 IRDLLNITEPLWTRSVSLPHRDNMGLFLEKKSQTGLNT--ESLTYSQFIKQQG 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13996NP_608980.1 SAM_superfamily 85..151 CDD:301707 26/89 (29%)
SAM 86..147 CDD:197735 24/61 (39%)
samd15XP_002938914.2 SAM_superfamily 22..87 CDD:301707 25/65 (38%)
SAM 24..86 CDD:197735 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008070
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.