DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33213 and CTCF

DIOPT Version :8

Sequence 1:NP_788749.1 Gene:CG33213 / 338395 FlyBaseID:FBgn0053213 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster

Alignment Length:496 Identity:99/497 (20%)
Similarity:148/497 (30%) Gaps:186/497 (37%)


  Fly     5 QPAKVALAGQPISAGKPPRHSPVQMKSIPL--------PVFELPEYVCVETKWVTRKYAIENGIP 61
            :||:.|.|....||..||   |..:..:|.        ||...||.:.:|.:             
  Fly   158 RPARAAAAKAKQSAMPPP---PALVVKVPAPRGRPRKNPVIPKPEPMDLERE------------- 206

  Fly    62 VKEL-HAPITNGGATESPKKSVQQKRLNEVTG-MFANEAMVPRRE--RAIQTENAGTKDAGIQCR 122
            ::|| ..|..:...||....:|.:..:...|. :..|||.|...|  ...:.|||..||  :...
  Fly   207 LEELVDEPDISSMVTELSDYTVDEAAVEAATATLTPNEAEVYEFEDNATTEDENADKKD--VDFV 269

  Fly   123 RDSEEWYLPEERPKDTGSEASN------------SDKFL-TYVSENTFIFPNGMMECAVC----- 169
            ..::|..|.........|.||.            |.||| |..|.:..:.|:  .:|::|     
  Fly   270 LSNKEVKLKTASSTSQNSNASGHKYSCPHCPYTASKKFLITRHSRSHDVEPS--FKCSICERSFR 332

  Fly   170 ------------------------------GDVAK-TLLEH---------------------QSH 182
                                          |::.: |..:|                     :.|
  Fly   333 SNVGLQNHINTHMGNKPHKCKLCESAFTTSGELVRHTRYKHTKEKPHKCTECTYASVELTKLRRH 397

  Fly   183 MTAHYGPGAL-----------------------------CFRCGQRLDHQKQLKQHSL------- 211
            ||.|.|....                             |..|..|......||.|.|       
  Fly   398 MTCHTGERPYQCPHCTYASQDMFKLKRHMVIHTGEKKYQCDICKSRFTQSNSLKAHKLIHSVVDK 462

  Fly   212 ------SCPALAPRKSSMLFKCPHL----------LCNAMSHSEMQLLRHLRNHSGRKCYRCLQC 260
                  .||....||:.:.....|:          .|........|...|:::|.|.|||.|..|
  Fly   463 PVFQCNYCPTTCGRKADLRVHIKHMHTSDVPMTCRRCGQQLPDRYQYKLHVKSHEGEKCYSCKLC 527

  Fly   261 KRYFKTT-----TSLLVHRKKE----QSCAKA-KVVVLFREHNGL--------PNGRGDPRRCSV 307
            . |...|     :.:|:|..::    ..|.:| :...|.|.|..|        |..|....:|..
  Fly   528 S-YASVTQRHLASHMLIHLDEKPFHCDQCPQAFRQRQLLRRHMNLVHNEEYQPPEPREKLHKCPS 591

  Fly   308 CLKRFSSERVCLRH-------------RRQCILGHFRRLSR 335
            |.:.|:.:...:||             ||:..||...||.:
  Fly   592 CPREFTHKGNLMRHMETHDDSANAREKRRRLKLGRNVRLQK 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33213NP_788749.1 C2H2 Zn finger 257..292 CDD:275368 10/45 (22%)
C2H2 Zn finger 305..323 CDD:275368 6/31 (19%)
CTCFNP_648109.1 23ISL <116..206 CDD:293226 15/51 (29%)
C2H2 Zn finger 296..316 CDD:275368 6/20 (30%)
COG5048 321..>621 CDD:227381 51/303 (17%)
zf-C2H2 322..344 CDD:278523 2/22 (9%)
C2H2 Zn finger 324..344 CDD:275368 2/20 (10%)
zf-H2C2_2 337..361 CDD:290200 0/24 (0%)
C2H2 Zn finger 352..373 CDD:275368 2/21 (10%)
C2H2 Zn finger 381..401 CDD:275368 3/20 (15%)
zf-H2C2_2 394..415 CDD:290200 5/21 (24%)
C2H2 Zn finger 409..429 CDD:275368 0/20 (0%)
zf-H2C2_2 422..446 CDD:290200 3/24 (13%)
C2H2 Zn finger 437..457 CDD:275368 7/20 (35%)
C2H2 Zn finger 467..485 CDD:275368 4/18 (22%)
C2H2 Zn finger 496..516 CDD:275370 3/20 (15%)
C2H2 Zn finger 524..544 CDD:275368 5/21 (24%)
zf-H2C2_2 536..561 CDD:290200 4/25 (16%)
C2H2 Zn finger 552..573 CDD:275368 6/21 (29%)
zf-C2H2 587..609 CDD:278523 5/22 (23%)
C2H2 Zn finger 589..609 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.