DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and GLB1L2

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001357389.1 Gene:GLB1L2 HGNCID:25129 Length:690 Species:Homo sapiens

Alignment Length:680 Identity:222/681 (33%)
Similarity:323/681 (47%) Gaps:122/681 (18%)


  Fly    55 FMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVV 119
            |||:...|....||.||||...|.||.||..|:|.|||.|.|||.|:||.|..|::::.|..|:.
Human    54 FMLEDSTFWIFGGSIHYFRVPREYWRDRLLKMKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLE 118

  Fly   120 KFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRL 184
            .|:.:|.|...::|||||||||:|.|.||||.||. :.|.:::||....:...|..::..||.|:
Human   119 AFVLMAAEIGLWVILRPGPYICSEMDLGGLPSWLL-QDPGMRLRTTYKGFTEAVDLYFDHLMSRV 182

  Fly   185 QHLFVGNGGKIIMVQVENEYGDYACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIEN- 248
            ..|....||.||.||||||||.|..|..|:.:::...|.  .|...|.......:.:|.|.::. 
Human   183 VPLQYKRGGPIIAVQVENEYGSYNKDPAYMPYVKKALED--RGIVELLLTSDNKDGLSKGIVQGD 245

  Fly   249 -----------------------------------------------------VFATTDFGIDRI 260
                                                                 |.||  ..:...
Human   246 PQPGGLCSSSRELHGCSPKLARLSVAPHLKLNFFLRGAHSILLPAFFSPSHLPVLAT--INLQST 308

  Fly   261 NEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNASVNLYMFFG 325
            :|:..:...|..:|.|.|.:..|::.||...|...:...|..||...:..|:...:|:|||||.|
Human   309 HELQLLTTFLFNVQGTQPKMVMEYWTGWFDSWGGPHNILDSSEVLKTVSAIVDAGSSINLYMFHG 373

  Fly   326 GTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAVIGEF----LP-----L 381
            ||||||..||.:..|    |.:|:||||||||:.|||..|.||..::...|..    ||     |
Human   374 GTNFGFMNGAMHFHD----YKSDVTSYDYDAVLTEAGDYTAKYMKLRDFFGSISGIPLPPPPDLL 434

  Fly   382 PEITLNPAKRLAYGRVELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELDLYS------GLVLY 440
            |::...|          |||.|.|...:....|  |:|::|.||...|.|.:..      |.:||
Human   435 PKMPYEP----------LTPVLYLSLWDALKYL--GEPIKSEKPINMENLPVNGGNGQSFGYILY 487

  Fly   441 ETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVN 505
            ||.:.|..     :....::||..|||:...:|.|..:....::||.:|: :.|::||||:||||
Human   488 ETSITSSG-----ILSGHVHDRGQVFVNTVSIGFLDYKTTKIAVPLIQGY-TVLRILVENRGRVN 546

  Fly   506 F--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQRI 568
            :  .|.:..||:.|  :|.|::.   ||:|:|..:..:::|..:.:..:........|.|     
Human   547 YGENIDDQRKGLIG--NLYLNDS---PLKNFRIYSLDMKKSFFQRFGLDKWSSLPETPTL----- 601

  Fly   569 LRNGPILYTGSLTVTEVG-DTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEILKVGEN 632
                |..:.|||:::... ||:|.:.||.|||.::||.||||||.: |||.|||:|...|..|.|
Human   602 ----PAFFLGSLSISSTPCDTFLKLEGWEKGVVFINGQNLGRYWNI-GPQKTLYLPGPWLSSGIN 661

  Fly   633 SLVILEYQRANKTATGEDLPAVQFDAVAQL 662
            .:::.|     :|..|   ||:||.....|
Human   662 QVIVFE-----ETMAG---PALQFTETPHL 683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 127/375 (34%)
BetaGal_dom4_5 <570..637 CDD:290101 30/68 (44%)
GLB1L2NP_001357389.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13185552
eggNOG 1 0.900 E1_COG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128163
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.