DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL16

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001320597.1 Gene:BGAL16 AraportID:AT1G77410 Length:820 Species:Arabidopsis thaliana

Alignment Length:761 Identity:179/762 (23%)
Similarity:292/762 (38%) Gaps:218/762 (29%)


  Fly    18 LIIAVMALTVGLCVGLSGDTDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSR 82
            :.:.:||:.|      :||.        ..:.::..:.::||:.....|||.||.|:.|:.|.|.
plant     9 VFLVLMAVIV------AGDV--------ANVTYDGRSLIIDGEHKILFSGSIHYTRSTPQMWPSL 59

  Fly    83 LRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNG 147
            :...::.|::.:||||.|::|.|..|::::.|..|:|||::..:....|:.||.||:|..|...|
plant    60 IAKAKSGGIDVVDTYVFWNVHEPQQGQFDFSGSRDIVKFIKEVKNHGLYVCLRIGPFIQGEWSYG 124

  Fly   148 GLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRL---QHLFVGNGGKIIM-----VQVENEY 204
            |||.||. ....|..||::..:...: |.||:::.:|   ::|:...||.||:     .|:||||
plant   125 GLPFWLH-NVQGIVFRTDNEPFKYHM-KRYAKMIVKLMKSENLYASQGGPIILSQLCAKQIENEY 187

  Fly   205 GDYACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIENVFATTDFGIDRINEIDKIWAM 269
            |...      ...|.|.:.||...|.| .|::                 |.|:.        |.|
plant   188 GMVG------RAFRQEGKSYVKWTAKL-AVEL-----------------DTGVP--------WVM 220

  Fly   270 LRALQPTGPLVNS-------EFYPG---------WLTHWQ-------EQNQRRDGQEVANALRTI 311
            .:......||||:       |.:.|         |..:|.       |:...|..:::|..:...
plant   221 CKQDDAPDPLVNACNGRQCGETFKGPNSPNKPAIWTENWTSFYQTYGEEPLIRSAEDIAFHVALF 285

  Fly   312 LSYNAS-VNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAG------------- 362
            ::.|.| ||.||:.||||||..|....           ||||...|.:||.|             
plant   286 IAKNGSFVNYYMYHGGTNFGRNASQFV-----------ITSYYDQAPLDEYGLLRQPKWGHLKEL 339

  Fly   363 -------------GVTT---------------KYNLVKAVI----------------GEFLPLPE 383
                         |:.|               |.||..|::                ....|...
plant   340 HAAVKLCEEPLLSGLQTTISLGKLQTAFVFGKKANLCAAILVNQDKCESTVQFRNSSYRLSPKSV 404

  Fly   384 ITLNPAKRLAYGRVELTPKLTLLSTEGRAALSKGDPVESIKP--KTFEELDLYSGLVL------- 439
            ..|...|.:|:...::..:....:.:.|..||.....|....  .:|.|..:.|..:|       
plant   405 SVLPDCKNVAFNTAKVNAQYNTRTRKARQNLSSPQMWEEFTETVPSFSETSIRSESLLEHMNTTQ 469

  Fly   440 -------YETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSREAQIYSLPLSKGWG-----S 492
                   ..|.....:..|::||::.:....|.||:...:|::....:.:...|.|...     :
plant   470 DTSDYLWQTTRFQQSEGAPSVLKVNHLGHALHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTN 534

  Fly   493 TLQLL-----VENQGRVNFYISNDTKGIFGEVSLQLHNGGY------------LPLENWRSTAFP 540
            .|.||     :.|.|      ::..:.:.|..|:::.||.|            :.|:..:...:.
plant   535 NLALLSVMVGLPNSG------AHLERRVVGSRSVKIWNGRYQLYFNNYSWGYQVGLKGEKFHVYT 593

  Fly   541 LEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGD-TYLNMAGWGKGVAYVNG 604
            .:.||...| :::.|.|: .||           ..|..|....|..| ..||:...|||.|:|||
plant   594 EDGSAKVQW-KQYRDSKS-QPL-----------TWYKASFDTPEGEDPVALNLGSMGKGEAWVNG 645

  Fly   605 FNLGRYW---------PVAGPQVTLYVPNEILKVGENSLVILEYQR 641
            .::||||         |   .|:..::|...||...|.|||||.:|
plant   646 QSIGRYWVSFHTYKGNP---SQIWYHIPRSFLKPNSNLLVILEEER 688

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 105/411 (26%)
BetaGal_dom4_5 <570..637 CDD:290101 26/77 (34%)
BGAL16NP_001320597.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.