DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL17

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001321343.1 Gene:BGAL17 AraportID:AT1G72990 Length:697 Species:Arabidopsis thaliana

Alignment Length:678 Identity:241/679 (35%)
Similarity:352/679 (52%) Gaps:62/679 (9%)


  Fly     6 RNRKLTMAVSGCLIIAVMALTVGLCVGLSGDTDAPEEQP------------RFTIDHEANTFMLD 58
            |.|:..:|....|::.|:.:.|.:...|...:..|:..|            :|.|  :.:.|..|
plant    11 RQRRHQLASMLLLVLVVVGIYVPVFALLPSLSYTPQSLPSAIPQDEKMISRKFYI--KDDNFWKD 73

  Fly    59 GQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLE 123
            |..|:.:.|..||||.:||.|..||....|.|||.:..||.|:||.|..|:..:|||.|:|.||:
plant    74 GNRFQIIGGDLHYFRVLPEYWEDRLLRANALGLNTIQVYVPWNLHEPKPGKMVFEGIGDLVSFLK 138

  Fly   124 IAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLF 188
            :.::.||.::||.|||||.|.|.||.|.||....|.:::||:||.|:..|.:|:..|:|::..|.
plant   139 LCEKLDFLVMLRAGPYICGEWDLGGFPAWLLAVKPRLQLRTSDPVYLKLVERWWDVLLPKVFPLL 203

  Fly   189 VGNGGKIIMVQVENEYGDYACDHDYLNWLRDETEKYVSGKALLFTVD-IPNEKMSCG--KIENVF 250
            ..|||.:||||:|||||.|..|..||..|......::....:::|.| ...|.:..|  .:.:|:
plant   204 YSNGGPVIMVQIENEYGSYGNDKAYLRKLVSMARGHLGDDIIVYTTDGGTKETLDKGTVPVADVY 268

  Fly   251 ATTDFGIDRINEIDKIWAMLRALQP------TGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALR 309
            :..||...     |..|.:.: ||.      ..|.::||||.||||||.|:..:.|.:..|.:|.
plant   269 SAVDFSTG-----DDPWPIFK-LQKKFNAPGRSPPLSSEFYTGWLTHWGEKITKTDAEFTAASLE 327

  Fly   310 TILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGV-TTKYNLVKA 373
            .|||.|.|..|||..|||||||..|||...:.. .|..|:|||||||.:.|:|.: ..|:..::.
plant   328 KILSRNGSAVLYMVHGGTNFGFYNGANTGSEES-DYKPDLTSYDYDAPIKESGDIDNPKFQALQR 391

  Fly   374 VIGEFLPLPE-ITLNPAKRLAYGRVELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELDLYSGL 437
            ||.::...|. |:.:..:|.|||.:::....:|....  ......|.:.|..|.:.|.:....|.
plant   392 VIKKYNASPHPISPSNKQRKAYGSIKMQMTTSLFDLV--RMTDPADVITSANPISMESVGQMFGF 454

  Fly   438 VLYETELPSMDLDPALLKIDQINDRAHVFV---DQEL-------VGTLSR-EAQIYSLP-LSKGW 490
            :|||:...:.. ....|:|.:::|||.|||   .|::       :||..| ..|..||| :....
plant   455 LLYESSYIAKK-SGNTLRIPKVHDRAQVFVSCLSQDVDVGVLRYIGTTERWNNQPISLPTIECTT 518

  Fly   491 GSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFP---LEQSAVELWR 550
            .::|.:||||.||||:  ||.:| |||...|.|.    |.: |..|:....|   |.|.....:.
plant   519 NTSLFILVENMGRVNYGPYIFDD-KGILSSVYLD----GQI-LHGWKMIPIPFHNLNQEPNLTFE 577

  Fly   551 REHTDEKALDPLLARQRILRNGPILYTGSLTVT---EVGDTYLNMAGWGKGVAYVNGFNLGRYWP 612
            .:||..::....|... :.|..|.|:.|..::.   |:.||||:..|||||||:||.||:|||||
plant   578 MQHTKNRSKKFELTND-VGRKEPALFAGEFSINSEEEIKDTYLSFNGWGKGVAFVNEFNIGRYWP 641

  Fly   613 VAGPQVTLYVPNEILKVGENSLVILEYQ 640
            ..|||..||||..:||.|:|:||:.|.:
plant   642 SVGPQCNLYVPAPLLKRGKNTLVVFELE 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 134/332 (40%)
BetaGal_dom4_5 <570..637 CDD:290101 38/70 (54%)
BGAL17NP_001321343.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 416 1.000 Inparanoid score I432
OMA 1 1.010
OrthoDB 1 1.010 D179316at2759
OrthoInspector 1 1.000 T125435
orthoMCL 1 0.900 OOG5_128163
Panther 1 1.100 O PTHR23421
Phylome 1 0.910 0.800 Consistency score
87.980

Return to query results.
Submit another query.