DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL5

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_175127.1 Gene:BGAL5 AraportID:AT1G45130 Length:732 Species:Arabidopsis thaliana

Alignment Length:763 Identity:182/764 (24%)
Similarity:274/764 (36%) Gaps:248/764 (32%)


  Fly    47 TIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYN 111
            ::.::....:::|.....:|||.||.|:.||.|...::..:..||:.:||||.|:.|.|..|.||
plant    30 SVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKKAKDGGLDVIDTYVFWNGHEPSPGTYN 94

  Fly   112 WEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKY-PSIKMRTNDPNYISEVGK 175
            :||..|:|:|::..||...|:.||.|||:|||.:.||.|.||  || ..|..||::..:.|.:..
plant    95 FEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEWNFGGFPVWL--KYVDGISFRTDNGPFKSAMQG 157

  Fly   176 WYAEL--MPRLQHLFVGNGGKIIMVQVENEY-----GDYACDHDYLNWLRDETEKYVSGKALLFT 233
            :..::  |.:....|...||.||:.|:|||:     |.....|.|:||.                
plant   158 FTEKIVQMMKEHRFFASQGGPIILSQIENEFEPDLKGLGPAGHSYVNWA---------------- 206

  Fly   234 VDIPNEKMSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVN----------------- 281
                 .||:.|        .:.|:.        |.|.:......|::|                 
plant   207 -----AKMAVG--------LNTGVP--------WVMCKEDDAPDPIINTCNGFYCDYFTPNKPYK 250

  Fly   282 ----SEFYPGWLTHWQEQNQRRDGQEVA-NALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDG 341
                :|.:.||.|.:.....:|..:::| ...|.|....:.:|.||:.||||||.|||..:    
plant   251 PTMWTEAWSGWFTEFGGTVPKRPVEDLAFGVARFIQKGGSYINYYMYHGGTNFGRTAGGPF---- 311

  Fly   342 GIGYAADITSYDYDAVMDEAGGV-TTKYNLVKAVIGEFLPLPEITLNPA-KRLAYGRVELTPKLT 404
                  ..|||||||.:||.|.| ..||:.:|            .|:.| |:.....|...|.:|
plant   312 ------ITTSYDYDAPIDEYGLVQEPKYSHLK------------QLHQAIKQCEAALVSSDPHVT 358

  Fly   405 LLSTEGRA---ALSKGDPVE---------------------------SIKP-------------- 425
            .|.....|   ...||..|.                           ||.|              
plant   359 KLGNYEEAHVFTAGKGSCVAFLTNYHMNAPAKVVFNNRHYTLPAWSISILPDCRNVVFNTATVAA 423

  Fly   426 KTFEELDLYSGLVLYETE------------------------------------LPSMDLDPA-- 452
            ||.....:.||.:||...                                    ..|:|:..:  
plant   424 KTSHVQMVPSGSILYSVARYDEDIATYGNRGTITARGLLEQVNVTRDTTDYLWYTTSVDIKASES 488

  Fly   453 --------LLKIDQINDRAHVFVDQELVGTL--SREAQIYSLPLS---KGWGSTLQLLVENQGRV 504
                    .|.:|......||||:....|:.  :||.:.:|....   :|..:.:.||....|..
plant   489 FLRGGKWPTLTVDSAGHAVHVFVNGHFYGSAFGTRENRKFSFSSQVNLRGGANKIALLSVAVGLP 553

  Fly   505 NF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAF-------------PLEQSAVELWRREHT 554
            |.  :......||.|.|.|...:.|...| :|:...:             |.|.|:|: |.:...
plant   554 NVGPHFETWATGIVGSVVLHGLDEGNKDL-SWQKWTYQAGLRGESMNLVSPTEDSSVD-WIKGSL 616

  Fly   555 DEKALDPLLARQRIL----RNGPILYTGSLTVTEVGDTYLNMAGWGKGVAYVNGFNLGRYWPV-- 613
            .::...||...:...    .|.|:.              |::...|||.|::||.::||||..  
plant   617 AKQNKQPLTWYKAYFDAPRGNEPLA--------------LDLKSMGKGQAWINGQSIGRYWMAFA 667

  Fly   614 ---------AG--------------PQVTLYVPNEILKVGENSLVILE 638
                     ||              .|...:||...||...|.||:.|
plant   668 KGDCGSCNYAGTYRQNKCQSGCGEPTQRWYHVPRSWLKPKGNLLVLFE 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 106/353 (30%)
BetaGal_dom4_5 <570..637 CDD:290101 23/92 (25%)
BGAL5NP_175127.1 Glyco_hydro_35 37..340 CDD:279624 107/364 (29%)
BetaGal_dom4_5 <472..552 CDD:290101 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.