DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL15

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001319124.1 Gene:BGAL15 AraportID:AT1G31740 Length:779 Species:Arabidopsis thaliana

Alignment Length:779 Identity:177/780 (23%)
Similarity:286/780 (37%) Gaps:234/780 (30%)


  Fly    48 IDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNW 112
            :.|:.....:||.....:|||.||.|:..|.|...::..:...|:|::|||.|:.|.|...:|::
plant    22 VSHDGRAITIDGHRRVLLSGSIHYPRSTTEMWPDLIKKGKEGSLDAIETYVFWNAHEPTRRQYDF 86

  Fly   113 EGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWY 177
            .|..|:::||:..|.|..|.:||.|||:|||.:.||.|.||. ..|.::.||.:..:::|:..:.
plant    87 SGNLDLIRFLKTIQNEGMYGVLRIGPYVCAEWNYGGFPVWLH-NMPGMEFRTTNTAFMNEMQNFT 150

  Fly   178 AEL--MPRLQHLFVGNGGKIIMVQVENEYGDYACDHD-----YLNWLRDETEKYVSGKALLFTVD 235
            ..:  |.:.:.||...||.||:.|:|||||:....:.     |:.|                   
plant   151 TMIVEMVKKEKLFASQGGPIILAQIENEYGNVIGSYGEAGKAYIQW------------------- 196

  Fly   236 IPNEKMSCGKIENVFATTDFGIDRI--NEIDKIWAMLRAL-----------QPTGPLVNSEFYPG 287
                   |..:.|   :.|.|:..|  .:.|....||...           .|..|.:.:|.:.|
plant   197 -------CANMAN---SLDVGVPWIMCQQDDAPQPMLNTCNGYYCDNFSPNNPNTPKMWTENWTG 251

  Fly   288 WLTHWQEQNQRRDGQEVANALRTILSYNASV-NLYMFFGGTNFGFTAGANYNLDGGIGYAADITS 351
            |..:|..::..|..::||.|:........:. |.||:.|||||..|||..|          ..|:
plant   252 WYKNWGGKDPHRTTEDVAFAVARFFQKEGTFQNYYMYHGGTNFDRTAGGPY----------ITTT 306

  Fly   352 YDYDAVMDEAGGVTTKYNLVKAVIGEFLPLPEITLNPAKRLAYGRVEL----------------- 399
            |||||.:||.|      ||.:...|....|.::.....|.|.||.:..                 
plant   307 YDYDAPLDEFG------NLNQPKYGHLKQLHDVLHAMEKTLTYGNISTVDFGNLVTATVYQTEEG 365

  Fly   400 ---------------------------------------TPKLTLLSTEGRAALSKGDPVESIKP 425
                                                   |.....::|:....:.|.:..|: :|
plant   366 SSCFIGNVNETSDAKINFQGTSYDVPAWSVSILPDCKTETYNTAKINTQTSVMVKKANEAEN-EP 429

  Fly   426 KTF------EELD--------------LY---------SGLVLYETELPSMDLDPALLK--IDQI 459
            .|.      |.:|              |:         |..:.|.|.:...:.||.|.|  ..:|
plant   430 STLKWSWRPENIDSVLLKGKGESTMRQLFDQKVVSNDESDYLWYMTTVNLKEQDPVLGKNMSLRI 494

  Fly   460 NDRAHV---FVDQELVGTLSREAQIYSLPLSKG-----WGSTLQLLVENQGRVNF--YISNDTKG 514
            |..|||   ||:.:.:|....|...:.....:.     ..:.:.||....|..|:  :..|.:.|
plant   495 NSTAHVLHAFVNGQHIGNYRVENGKFHYVFEQDAKFNPGANVITLLSITVGLPNYGAFFENFSAG 559

  Fly   515 IFGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGS 579
            |.|.|.:...||                            ||..:..|...:...:.|...:...
plant   560 ITGPVFIIGRNG----------------------------DETIVKDLSTHKWSYKTGLSGFENQ 596

  Fly   580 LTVTEVGDTY----------LNMAGWGKGVAYVNGFNLGRYWP-----VAGPQVTLYVPNEIL-K 628
            |..:|...|:          :::.|.|||.|::||.|:|||||     :.|.....:||...| .
plant   597 LFSSESPSTWSAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWPAFLSDIDGCSAEYHVPRSFLNS 661

  Fly   629 VGENSLVILE-----------------------YQR--ANKTATGEDLPAVQFDAVAQLDGESG 667
            .|:|:||:.|                       |::  ...:..|:.:.|::|.:.....|:.|
plant   662 EGDNTLVLFEEIGGNPSLVNFQTIGVGSVCANVYEKNVLELSCNGKPISAIKFASFGNPGGDCG 725

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 99/343 (29%)
BetaGal_dom4_5 <570..637 CDD:290101 25/83 (30%)
BGAL15NP_001319124.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.