DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and MUM2

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_568978.2 Gene:MUM2 AraportID:AT5G63800 Length:718 Species:Arabidopsis thaliana

Alignment Length:763 Identity:179/764 (23%)
Similarity:309/764 (40%) Gaps:223/764 (29%)


  Fly    17 CLIIAVMALTVGLCVGLSGDTDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRS 81
            |||     |.||..:..||...|.:     .:.::..:.::|||.....|||.||.|:.||.|.|
plant    11 CLI-----LIVGTFLEFSGGATAAK-----GVTYDGRSLIIDGQRKLLFSGSIHYPRSTPEMWPS 65

  Fly    82 RLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDN 146
            .::..:..|::.:.|||.|:||.|..|:|::.|..|:|||::..:.:..|:.||.||:|.||.:.
plant    66 LIKKTKEGGIDVIQTYVFWNLHEPKLGQYDFSGRNDLVKFIKEIRSQGLYVCLRIGPFIEAEWNY 130

  Fly   147 GGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAEL--MPRLQHLFVGNGGKIIMVQVENEYGDY-A 208
            ||||.|| ...|.:..||::..:...:.|:.|::  :.:.:.|:...||.||:.|:||||.:. .
plant   131 GGLPFWL-RDVPGMVYRTDNEPFKFHMQKFTAKIVDLMKSEGLYASQGGPIILSQIENEYANVEG 194

  Fly   209 CDHD----YLNWLRDETEKYVSGK-ALLFTVDIPNEKMSCGKIENVFATTDFGIDRINEIDKIWA 268
            ..|:    |:.|         :|: |:.....:|                             |.
plant   195 AFHEKGASYIKW---------AGQMAVGLKTGVP-----------------------------WI 221

  Fly   269 MLRALQPTGPLVNS-------EFYPG---------WLTHWQ-------EQNQRRDGQEVANALRT 310
            |.::.....|::|:       |.:||         |...|.       ::...|..:::|.....
plant   222 MCKSPDAPDPVINTCNGMKCGETFPGPNSPNKPKMWTEDWTSFFQVYGKEPYIRSAEDIAFHAAL 286

  Fly   311 ILSYNAS-VNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGV-TTKYNLVK- 372
            .::.|.| :|.||:.||||||.|:.:.:           ||.|...|.:||.|.: ..||..:| 
plant   287 FVAKNGSYINYYMYHGGTNFGRTSSSYF-----------ITGYYDQAPLDEYGLLRQPKYGHLKE 340

  Fly   373 ---AVIGEFLPLPE-----ITLNPAKRLAY-------GRVELTPKLTLLSTEGRAA-LSKGDPVE 421
               |:.....||.:     ::|.|.:: ||       |.|..     |::.:.:|: :...:...
plant   341 LHAAIKSSANPLLQGKQTILSLGPMQQ-AYVFEDANNGCVAF-----LVNNDAKASQIQFRNNAY 399

  Fly   422 SIKPKTFEELDLYSGLVLYETELPSMDLD-----------------------PAL----LKIDQI 459
            |:.||:...|.....|: |||...::.::                       ||.    ||.:.:
plant   400 SLSPKSIGILQNCKNLI-YETAKVNVKMNTRVTTPVQVFNVPDNWNLFRETIPAFPGTSLKTNAL 463

  Fly   460 NDR------------------------------------AHVFVDQELVGT--LSREAQIYSL-- 484
            .:.                                    .||||:..|.|:  .||:.::..|  
plant   464 LEHTNLTKDKTDYLWYTSSFKLDSPCTNPSIYTESSGHVVHVFVNNALAGSGHGSRDIRVVKLQA 528

  Fly   485 PLSKGWGSTLQLLVENQGRVNFYISNDTKGI-----------FGEVSLQLHNGGYLPLE----NW 534
            |:|         |:..|.  |..|.:...|:           :|...:|:..||..|::    .|
plant   529 PVS---------LINGQN--NISILSGMVGLPDSGAYMERRSYGLTKVQISCGGTKPIDLSRSQW 582

  Fly   535 -RSTAFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGD--TYLNMAGWG 596
             .|.....|:..:..|:..:..:.:::    :..:::|.|:.:..:......||  ..|:|:..|
plant   583 GYSVGLLGEKVRLYQWKNLNRVKWSMN----KAGLIKNRPLAWYKTTFDGPNGDGPVGLHMSSMG 643

  Fly   597 KGVAYVNGFNLGRYW-----PVAGPQVTLY-VPNEILKVGENSLVILE 638
            ||..:|||.::||||     |...|..::| :|...||...|.||:.|
plant   644 KGEIWVNGESIGRYWVSFLTPAGQPSQSIYHIPRAFLKPSGNLLVVFE 691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 97/359 (27%)
BetaGal_dom4_5 <570..637 CDD:290101 25/75 (33%)
MUM2NP_568978.2 Glyco_hydro_35 38..343 CDD:279624 96/355 (27%)
BetaGal_dom4_5 449..542 CDD:290101 19/104 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.