DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL4

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_200498.1 Gene:BGAL4 AraportID:AT5G56870 Length:724 Species:Arabidopsis thaliana

Alignment Length:766 Identity:191/767 (25%)
Similarity:305/767 (40%) Gaps:210/767 (27%)


  Fly    17 CLIIAVMALTVGLCVGLSGDTDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRS 81
            |:.:|::.     |:.||....|       ::.::....:::||....:|||.||.|:.||.|..
plant    10 CIFLAILC-----CLSLSCIVKA-------SVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPG 62

  Fly    82 RLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDN 146
            .::..:..||:.::|||.|:.|.|..|:|.:....|:|||:::..:...|:.||.|||:|||.:.
plant    63 LIQKAKEGGLDVIETYVFWNGHEPSPGQYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNF 127

  Fly   147 GGLPHWLFTKY-PSIKMRTNDPNYISEVGKWYAEL--MPRLQHLFVGNGGKIIMVQVENEYGDY- 207
            ||.|.||  |: |.:..||::..:.:.:.|:..::  |.:.:.||...||.||:.|:|||||.. 
plant   128 GGFPVWL--KFVPGMAFRTDNEPFKAAMKKFTEKIVWMMKAEKLFQTQGGPIILAQIENEYGPVE 190

  Fly   208 ----ACDHDYLNWLRDETEKYVSGKALLFTVDIP----NEKMSCGKIE---NVFATTDFGIDRIN 261
                |....|..|        |:..||..:..:|    .::.:.|.|.   |.:...||..:.||
plant   191 WEIGAPGKAYTKW--------VAQMALGLSTGVPWIMCKQEDAPGPIIDTCNGYYCEDFKPNSIN 247

  Fly   262 EIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNAS-VNLYMFFG 325
            : .|:|              :|.:.||.|.:......|..:::|.::...:....| ||.||:.|
plant   248 K-PKMW--------------TENWTGWYTDFGGAVPYRPVEDIAYSVARFIQKGGSLVNYYMYHG 297

  Fly   326 GTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAG-GVTTKYNLVKAVIGEFLPLPE------ 383
            ||||..|||.         :.|  :||||||.:||.| ....||:.:|| :.:.:.|.|      
plant   298 GTNFDRTAGE---------FMA--SSYDYDAPLDEYGLPREPKYSHLKA-LHKAIKLSEPALLSA 350

  Fly   384 ---ITLNPAKRLAY--------------------GRV---------------------------- 397
               :|...||:.||                    .||                            
plant   351 DATVTSLGAKQEAYVFWSKSSCAAFLSNKDENSAARVLFRGFPYDLPPWSVSILPDCKTEVYNTA 415

  Fly   398 ------------------------ELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELDLY---- 434
                                    |.||......|..|..|     ||.|. .|:::.|.:    
plant   416 KVNAPSVHRNMVPTGTKFSWGSFNEATPTANEAGTFARNGL-----VEQIS-MTWDKSDYFWYIT 474

  Fly   435 -----SGLVLYETELPSMDLDPALLKIDQINDRAHVFVDQELVGT----LSREAQIYSLPLSKGW 490
                 ||....:|.      |..||.:.......||||:.:|.||    |......:|..:....
plant   475 DITIGSGETFLKTG------DSPLLTVMSAGHALHVFVNGQLSGTAYGGLDHPKLTFSQKIKLHA 533

  Fly   491 G-STLQLLVENQG--RVNFYISNDTKGIFGEVSLQLHNGGYLPLENWR-STAFPLEQSAVELWRR 551
            | :.:.||....|  .|..:.....||:.|.|:|:..|.|...:..|: |....::..|:.|   
plant   534 GVNKIALLSVAVGLPNVGTHFEQWNKGVLGPVTLKGVNSGTWDMSKWKWSYKIGVKGEALSL--- 595

  Fly   552 EHTDEKALDPLLAR-QRILRNGPILYTGSLTVTEVGD--TYLNMAGWGKGVAYVNGFNLGRYWPV 613
             ||:.::......: ..:.:..|:.:..|...|..|:  ..|:|...|||..::||.|:||:||.
plant   596 -HTNTESSGVRWTQGSFVAKKQPLTWYKSTFATPAGNEPLALDMNTMGKGQVWINGRNIGRHWPA 659

  Fly   614 ------------AG--------------PQVTLYVPNEILKVGENSLVILE 638
                        ||              .|...:||...|| .:|.:|:.|
plant   660 YKAQGSCGRCNYAGTFDAKKCLSNCGEASQRWYHVPRSWLK-SQNLIVVFE 709

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 106/339 (31%)
BetaGal_dom4_5 <570..637 CDD:290101 25/95 (26%)
BGAL4NP_200498.1 PLN03059 5..724 CDD:166698 191/767 (25%)
Glyco_hydro_35 37..338 CDD:279624 106/338 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.