DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL7

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_568399.4 Gene:BGAL7 AraportID:AT5G20710 Length:826 Species:Arabidopsis thaliana

Alignment Length:762 Identity:177/763 (23%)
Similarity:280/763 (37%) Gaps:233/763 (31%)


  Fly    48 IDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNW 112
            :.|:.....::|:....:|||.||.|:..:.|...:...:..||:|::|||.|:.|.|...||::
plant    28 VSHDERAITINGKRRILLSGSIHYPRSTADMWPDLINKAKDGGLDAIETYVFWNAHEPKRREYDF 92

  Fly   113 EGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWY 177
            .|..|||:|::..|:...|.:||.|||:|||.:.||.|.||. ..|::|.||.:|::::|:..:.
plant    93 SGNLDVVRFIKTIQDAGLYSVLRIGPYVCAEWNYGGFPVWLH-NMPNMKFRTVNPSFMNEMQNFT 156

  Fly   178 AEL--MPRLQHLFVGNGGKIIMVQVENEYGDYACDHD-----YLNWLRDETEKYVSGKALLFTVD 235
            .::  |.:.:.||...||.||:.|:|||||:....:.     |::|                   
plant   157 TKIVKMMKEEKLFASQGGPIILAQIENEYGNVISSYGAEGKAYIDW------------------- 202

  Fly   236 IPNEKMSCGKIENVFATTDFGIDRINEIDKIWAMLR---------------------ALQPTGPL 279
                   |..:.|   :.|.|:.        |.|.:                     ...|:.|.
plant   203 -------CANMAN---SLDIGVP--------WLMCQQPNAPQPMLETCNGFYCDQYEPTNPSTPK 249

  Fly   280 VNSEFYPGWLTHWQEQNQRRDGQEVA-NALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGI 343
            :.:|.:.||..:|..::..|..:::| :..|...:.....|.||:.||||||..||..|      
plant   250 MWTENWTGWFKNWGGKHPYRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPY------ 308

  Fly   344 GYAADITSYDYDAVMDEAGGVTTKYNLVKAVIGEFLPLPEITLNPAKRLAYG---RVEL--TPKL 403
                ..|||||.|.:||.|      ||.:...|....|..:..:..|.|.||   |::|  :.|.
plant   309 ----ITTSYDYHAPLDEFG------NLNQPKWGHLKQLHTVLKSMEKSLTYGNISRIDLGNSIKA 363

  Fly   404 TLLST-EGRAAL-----SKGDPVESIKPKTF---------------------------------- 428
            |:.:| ||.:..     :..|.:.:.|.|.:                                  
plant   364 TIYTTKEGSSCFIGNVNATADALVNFKGKDYHVPAWSVSVLPDCDKEAYNTAKVNTQTSIMTEDS 428

  Fly   429 ---EELD-------------------LYSGLV-------------LYETELPSMDLDP-----AL 453
               |.|:                   :..|||             .|.|.|.....||     ..
plant   429 SKPERLEWTWRPESAQKMILKGSGDLIAKGLVDQKDVTNDASDYLWYMTRLHLDKKDPLWSRNMT 493

  Fly   454 LKIDQINDRAHVFVDQELVGT---------LSREAQIYSLPLSKGWGSTLQLLVENQGRVNFYIS 509
            |::.......|.:|:.:.||.         ...|.::..|.......|.|.:.|..|....|:.|
plant   494 LRVHSNAHVLHAYVNGKYVGNQFVKDGKFDYRFERKVNHLVHGTNHISLLSVSVGLQNYGPFFES 558

  Fly   510 NDTKGIFGEVS-------------LQLHNGGY-LPLENWRSTAFPLEQSAVELWRREHTDEKALD 560
            ..| ||.|.||             |..|...| :.|..:....|.::....:.|..|.       
plant   559 GPT-GINGPVSLVGYKGEETIEKDLSQHQWDYKIGLNGYNDKLFSIKSVGHQKWANEK------- 615

  Fly   561 PLLARQRILRNGPILYTGSLTVTEVGDTYLNMAGWGKGVAYVNGFNLGRYWP------------- 612
              |...|:|......:...|....|   .:::.|.|||.|::||.::|||||             
plant   616 --LPTGRMLTWYKAKFKAPLGKEPV---IVDLNGLGKGEAWINGQSIGRYWPSFNSSDDGCKDEC 675

  Fly   613 -------------VAG--PQVTLYVPNEILKV-GENSLVILEYQRAN 643
                         :.|  .|...:||...|.. |.|::.:.|....|
plant   676 DYRGAYGSDKCAFMCGKPTQRWYHVPRSFLNASGHNTITLFEEMGGN 722

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 98/351 (28%)
BetaGal_dom4_5 <570..637 CDD:290101 21/96 (22%)
BGAL7NP_568399.4 PLN03059 6..826 CDD:166698 177/763 (23%)
Glyco_hydro_35 34..338 CDD:279624 100/358 (28%)
Gal_Lectin 748..826 CDD:280328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.