DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL14

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001154292.1 Gene:BGAL14 AraportID:AT4G38590 Length:1052 Species:Arabidopsis thaliana

Alignment Length:823 Identity:194/824 (24%)
Similarity:306/824 (37%) Gaps:267/824 (32%)


  Fly    19 IIAVMALTVGLCVGLSGDTDAPEEQ-------PRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVP 76
            :||:: |.:.||...|...|..:::       .|..|||:...           ..||.:|.::|
plant     8 LIAIL-LVISLCSKASSHDDEKKKKGVTYDGSERNFIDHKWKK-----------RASFLWFCSLP 60

  Fly    77 ES-------WRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIIL 134
            ..       |.|.:...|..|||.:.|||.|::|.|..|:|:::|..|:|||:::..|:..|:.|
plant    61 SKHTSRKHMWPSIIDKARIGGLNTIQTYVFWNVHEPEQGKYDFKGRFDLVKFIKLIHEKGLYVTL 125

  Fly   135 RPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAEL--MPRLQHLFVGNGGKIIM 197
            |.||:|.||.::||||:|| .:.|.:..|||:..:.....::..::  |.:.:.||...||.||:
plant   126 RLGPFIQAEWNHGGLPYWL-REVPDVYFRTNNEPFKEHTERYVRKILGMMKEEKLFASQGGPIIL 189

  Fly   198 VQVENEYGDYACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIENVFATTDFGIDRINE 262
            .|:||||.  |....|    ::..|||:...|                  |:..:.:.||.    
plant   190 GQIENEYN--AVQLAY----KENGEKYIKWAA------------------NLVESMNLGIP---- 226

  Fly   263 IDKIWAMLRALQPTGPLVNS-------EFYPG---------WLTHWQEQNQ-------RRDGQEV 304
                |.|.:.....|.|:|:       :.:||         |..:|..|.:       :|..:::
plant   227 ----WVMCKQNDAPGNLINACNGRHCGDTFPGPNRHDKPSLWTENWTTQFRVFGDPPTQRTVEDI 287

  Fly   305 ANALRTILSYNAS-VNLYMFFGGTNFGFTAGANYNLDGGIGYAADITS--YDYDAVMDEAG-GVT 365
            |.::....|.|.| ||.||:.||||||.|:            |..:|:  || ||.:||.| ...
plant   288 AFSVARYFSKNGSHVNYYMYHGGTNFGRTS------------AHFVTTRYYD-DAPLDEFGLEKA 339

  Fly   366 TKYNLVKAV--------------------IGE--------------------------------- 377
            .||..:|.|                    :|.                                 
plant   340 PKYGHLKHVHRALRLCKKALFWGQLRAQTLGPDTEVRYYEQPGTKVCAAFLSNNNTRDTNTIKFK 404

  Fly   378 ----FLPLPEITLNP-AKRLAYGRVELTPKLTLLSTEGRAALSKGDPVESIK---PKTFEELDLY 434
                .||...|::.| .|.:.|...::..:.:..........|||...|...   |...:...|.
plant   405 GQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRDFVKSEKTSKGLKFEMFSENIPSLLDGDSLI 469

  Fly   435 SGLVLYETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSREAQIYSLPLSKGWGSTLQLLVE 499
            .|.:.|.|:..:   |.|.:|||:.:     |.||:.:.|:.|.|.:         |..|.:.|.
plant   470 PGELYYLTKDKT---DYACVKIDEDD-----FPDQKGLKTILRVASL---------GHALIVYVN 517

  Fly   500 NQ------GR-----------VNFYISNDTKGIFGEVSLQLHNGGYLP----------------- 530
            .:      ||           |||...::...|.|.::....:|.|:.                 
plant   518 GEYAGKAHGRHEMKSFEFAKPVNFKTGDNRISILGVLTGLPDSGSYMEHRFAGPRAISIIGLKSG 582

  Fly   531 ---------------LENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILY--TG 578
                           ||..:...:..|.|....|.::.                :..|:.:  |.
plant   583 TRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVKWEKDG----------------KRKPLTWYKTY 631

  Fly   579 SLTVTEVGDTYLNMAGWGKGVAYVNGFNLGRYW-----PVAGPQVTLY-VPNEILKVGE---NSL 634
            ..|...|....:.|...|||:.:|||..:||||     |:..|..|.| :|...:| ||   |.|
plant   632 FETPEGVNAVAIRMKAMGKGLIWVNGIGVGRYWMSFLSPLGEPTQTEYHIPRSFMK-GEKKKNML 695

  Fly   635 VILEYQRANKTATGEDLPAVQF-----DAVAQLDGESGDVPLK 672
            ||||.:      .|..|.::.|     |.:....||...|.:|
plant   696 VILEEE------PGVKLESIDFVLVNRDTICSNVGEDYPVSVK 732

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 102/378 (27%)
BetaGal_dom4_5 <570..637 CDD:290101 27/78 (35%)
BGAL14NP_001154292.1 PLN03059 65..831 CDD:166698 179/755 (24%)
Glyco_hydro_35 67..350 CDD:279624 98/329 (30%)
Gal_Lectin 754..831 CDD:280328
PRP1_N 921..1050 CDD:283962
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.