DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL11

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_567973.1 Gene:BGAL11 AraportID:AT4G35010 Length:845 Species:Arabidopsis thaliana

Alignment Length:802 Identity:196/803 (24%)
Similarity:314/803 (39%) Gaps:233/803 (29%)


  Fly    18 LIIAVMALTVGLCVGLSGDTDA-PEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRS 81
            |:.||:.:.:......:...|| .:::....:.::..:.::||:.....|||.||.|:.||.|.|
plant    10 LLTAVLVVLLSSSSSFAAKKDAKKKKKSNKEVTYDGTSLIIDGKRELLYSGSIHYPRSTPEMWPS 74

  Fly    82 RLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDN 146
            .::..:..|||.:.|||.|::|.|..|::|:.|.||:|||:::.|:...|:.||.||:|.||..:
plant    75 IIKRAKQGGLNTIQTYVFWNVHEPQQGKFNFSGRADLVKFIKLIQKNGMYVTLRLGPFIQAEWTH 139

  Fly   147 GGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRL--QHLFVGNGGKIIMVQVENEYG--DY 207
            ||||:|| .:.|.|..||::..:.....::...::.::  :.||...||.||:.|:||||.  ..
plant   140 GGLPYWL-REVPGIFFRTDNKQFKEHTERYVRMILDKMKEERLFASQGGPIILGQIENEYSAVQR 203

  Fly   208 ACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIENVFATTDFGIDRINEIDKIWAMLRA 272
            |...|.||::     |:.|                     |:..:...||.        |.|.:.
plant   204 AYKQDGLNYI-----KWAS---------------------NLVDSMKLGIP--------WVMCKQ 234

  Fly   273 LQPTGPLVNS-------EFYPG---------WLTHWQEQNQ-------RRDGQEVANALRTILSY 314
            .....|::|:       :.:||         |..:|..|.:       :|..:::|.::....|.
plant   235 NDAPDPMINACNGRHCGDTFPGPNRENKPSLWTENWTTQFRVFGDPPTQRSVEDIAYSVARFFSK 299

  Fly   315 NAS-VNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAG-GVTTKYNLVKAVIGE 377
            |.: ||.||:.||||||.|: |:|          ..|.|..||.:||.| ....||..:|.:   
plant   300 NGTHVNYYMYHGGTNFGRTS-AHY----------VTTRYYDDAPLDEYGLEKEPKYGHLKHL--- 350

  Fly   378 FLPLPEITLNPAKR-LAYG--RVELTPKLTLL------STEGRAAL---SKGDPVESIK------ 424
                 ...||..|: |.:|  :.|...|.|.:      .|:..||.   :..:..|:||      
plant   351 -----HNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTKTCAAFLANNNTEAAETIKFKGREY 410

  Fly   425 ---PKTFEELDLYSGLVLYETELPSMDLDPALLKIDQINDR--AHVFVD---QELVGTLSREAQI 481
               |::...|.....:|....::.|.......:|..:.|.:  ..||.:   .:|.|......::
plant   411 VIAPRSISILPDCKTVVYNTAQIVSQHTSRNFMKSKKANKKFDFKVFTETLPSKLEGNSYIPVEL 475

  Fly   482 YSLPLSK---GWGSTLQLLVENQGRVNFYISND----TKGI-----FGEVSLQLH---NGGYLPL 531
            |.|...|   ||.:|           :|.:..:    .||:     ...:...||   ||.||..
plant   476 YGLTKDKTDYGWYTT-----------SFKVHKNHLPTKKGVKTFVRIASLGHALHAWLNGEYLGS 529

  Fly   532 ---------------------ENWR-----STAFPLEQSAVELWRREHTDEKALDPLLARQRILR 570
                                 ||..     .|.||...|.:|   ..:|..:.:..|        
plant   530 GHGSHEEKSFVFQKQVTLKAGENHLVMLGVLTGFPDSGSYME---HRYTGPRGISIL-------- 583

  Fly   571 NGPILYTGSLTVTE-------VG--------------------------------DTY------- 589
             |  |.:|:|.:||       :|                                .||       
plant   584 -G--LTSGTLDLTESSKWGNKIGMEGEKLGIHTEEGLKKVEWKKFTGKAPGLTWYQTYFDAPESV 645

  Fly   590 ----LNMAGWGKGVAYVNGFNLGRYW-----PVAGP-QVTLYVPNEILKVGENSLVILEYQRANK 644
                :.|.|.|||:.:|||..:||||     |:..| |:..::|...||..:|.|||.| :..|.
plant   646 SAATIRMHGMGKGLIWVNGEGVGRYWQSFLSPLGQPTQIEYHIPRSFLKPKKNLLVIFE-EEPNV 709

  Fly   645 TATGEDLPAVQFDAVAQLDGES 666
            .....|...|..|.|....||:
plant   710 KPELMDFAIVNRDTVCSYVGEN 731

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 104/351 (30%)
BetaGal_dom4_5 <570..637 CDD:290101 31/123 (25%)
BGAL11NP_567973.1 PLN03059 41..839 CDD:166698 191/772 (25%)
Glyco_hydro_35 47..352 CDD:279624 104/359 (29%)
BetaGal_dom4_5 468..554 CDD:290101 17/97 (18%)
Gal_Lectin 759..839 CDD:280328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.