DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL12

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001329559.1 Gene:BGAL12 AraportID:AT4G26140 Length:753 Species:Arabidopsis thaliana

Alignment Length:754 Identity:184/755 (24%)
Similarity:292/755 (39%) Gaps:209/755 (28%)


  Fly    48 IDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNW 112
            :.::....:::||....:|||.||.|:.||.|...::..:..||:.:.|||.|:.|.|..|:|.:
plant    29 VTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGQYYF 93

  Fly   113 EGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKY-PSIKMRTNDPNYISEVGKW 176
            |...|:|||:::.|:...|:.||.|||:|||.:.||.|.||  || |.:..||::..:.:.:.|:
plant    94 EDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWL--KYVPGMVFRTDNEPFKAAMQKF 156

  Fly   177 YAEL--MPRLQHLFVGNGGKIIMVQVENEYGDY-----ACDHDYLNWLRDETEKYVSGKALLFTV 234
            ..::  |.:.:.||...||.||:.|:|||||..     |....|..|:.:..:...:|...:...
plant   157 TEKIVRMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWVAEMAQGLSTGVPWIMCK 221

  Fly   235 --DIPNEKM-SCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQN 296
              |.||..: :|    |.|...:|..:..|: .|:|              :|.:.||.|.:....
plant   222 QDDAPNSIINTC----NGFYCENFKPNSDNK-PKMW--------------TENWTGWFTEFGGAV 267

  Fly   297 QRRDGQEVA-NALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDE 360
            ..|..:::| :..|.|.:..:.:|.||:.|||||..|||.         :.|  |||||||.:||
plant   268 PYRPAEDIALSVARFIQNGGSFINYYMYHGGTNFDRTAGE---------FIA--TSYDYDAPLDE 321

  Fly   361 AG--------------------------------------------------GVTTKYNLVKAVI 375
            .|                                                  ...:.||...|..
plant   322 YGLPREPKYSHLKRLHKVIKLCEPALVSADPTVTSLGDKQEAHVFKSKSSCAAFLSNYNTSSAAR 386

  Fly   376 GEF------LPLPEITLNPAKRLAY---GRVEL-TPKLTLLSTEGRAALSKGDPVESIKPK---- 426
            ..|      ||...:::.|..:..|   .:|:: |..:.:.........|.|...|.|...    
plant   387 VLFGGSTYDLPPWSVSILPDCKTEYYNTAKVQVRTSSIHMKMVPTNTPFSWGSYNEEIPSANDNG 451

  Fly   427 TF------EELDLYSGLVLYETELPSMDLDP---------ALLKIDQINDRAHVFVDQELVGTLS 476
            ||      |::.:......|...|..:.:.|         .||.|.......||||:.:|.|.: 
plant   452 TFSQDGLVEQISITRDKTDYFWYLTDITISPDEKFLTGEDPLLTIGSAGHALHVFVNGQLAGNI- 515

  Fly   477 REAQIY---SLPLSK---------GWGS-------------------TLQLLVENQGRVNFYISN 510
            :..|.:   |||||.         .:||                   .|.||....|..|..:..
plant   516 KIGQTHPHGSLPLSSVKHFFVSGTAYGSLEKPKLTFSQKIKLHAGVNKLALLSTAAGLPNVGVHY 580

  Fly   511 DT--KGIFGEVSLQLHNGGYLPLENWR-----------STAFPLEQSAVELWRREHTDEKALDPL 562
            :|  .|:.|.|:|...|.|...:..|:           .:...|..|:...|:.        ..|
plant   581 ETWNTGVLGPVTLNGVNSGTWDMTKWKWSYKIGTKGEALSVHTLAGSSTVEWKE--------GSL 637

  Fly   563 LARQRILRNGPILYTGSLTVTEVGD--TYLNMAGWGKGVAYVNGFNLGRYWPV------------ 613
            :|:::     |:.:..|...:..|:  ..|:|...|||..::||.|:||:||.            
plant   638 VAKKQ-----PLTWYKSTFDSPTGNEPLALDMNTMGKGQMWINGQNIGRHWPAYTARGKCERCSY 697

  Fly   614 AG--------------PQVTLYVPNEILKVGENSLVILE 638
            ||              .|...:||...||...|.:::||
plant   698 AGTFTEKKCLSNCGEASQRWYHVPRSWLKPTNNLVIVLE 736

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 107/384 (28%)
BetaGal_dom4_5 <570..637 CDD:290101 23/95 (24%)
BGAL12NP_001329559.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.