DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL2

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001325739.1 Gene:BGAL2 AraportID:AT3G52840 Length:781 Species:Arabidopsis thaliana

Alignment Length:785 Identity:198/786 (25%)
Similarity:309/786 (39%) Gaps:217/786 (28%)


  Fly     3 GCRRNRKLTMAV--SGCLIIAVMALTVGLCVGLSGDTDAPEEQPRFTIDHEANTFMLDGQPFRYV 65
            |..:|.|::|..  ...:|:|::..:     .|...|:|.     .|.||:|  .:::||....:
plant    48 GFSKNVKMSMHFRNKAWIILAILCFS-----SLIHSTEAV-----VTYDHKA--LIINGQRRILI 100

  Fly    66 SGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDF 130
            |||.||.|:.||.|...::..:..||:.:.|||.|:.|.|..|.|.::...|:|||.::..:...
plant   101 SGSIHYPRSTPEMWPDLIKKAKEGGLDVIQTYVFWNGHEPSPGNYYFQDRYDLVKFTKLVHQAGL 165

  Fly   131 YIILRPGPYICAERDNGGLPHWLFTKY-PSIKMRTNDPNYISEVGKWYAEL--MPRLQHLFVGNG 192
            |:.||.|||:|||.:.||.|.||  || |.:..||::..:...:.|:..::  |.:.:.||...|
plant   166 YLDLRIGPYVCAEWNFGGFPVWL--KYVPGMVFRTDNEPFKIAMQKFTKKIVDMMKEEKLFETQG 228

  Fly   193 GKIIMVQVENEYGDY-----ACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIE----- 247
            |.||:.|:|||||..     |....|..|..:        .||..:..:|  .:.|.:.:     
plant   229 GPIILSQIENEYGPMQWEMGAAGKAYSKWTAE--------MALGLSTGVP--WIMCKQEDAPYPI 283

  Fly   248 ----NVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVA-NA 307
                |.|....|..:..|: .|:|              :|.:.||.|.:......|..:::| :.
plant   284 IDTCNGFYCEGFKPNSDNK-PKLW--------------TENWTGWFTEFGGAIPNRPVEDIAFSV 333

  Fly   308 LRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGV-TTKYNLV 371
            .|.|.:..:.:|.||::|||||..|||.         :.|  |||||||.:||.|.: ..||:.:
plant   334 ARFIQNGGSFMNYYMYYGGTNFDRTAGV---------FIA--TSYDYDAPIDEYGLLREPKYSHL 387

  Fly   372 K---------------------------------------AVIGEF----------------LPL 381
            |                                       |.:..:                ||.
plant   388 KELHKVIKLCEPALVSVDPTITSLGDKQEIHVFKSKTSCAAFLSNYDTSSAARVMFRGFPYDLPP 452

  Fly   382 PEITLNPAKRLAYGR----------VELTPKLTLLSTEGRAALSKGDPVES-----IKPKTFEEL 431
            ..:::.|..:..|..          :::.|..|..|.|   :.::|.|..:     :|....|::
plant   453 WSVSILPDCKTEYYNTAKIRAPTILMKMIPTSTKFSWE---SYNEGSPSSNEAGTFVKDGLVEQI 514

  Fly   432 DL----------YSGLVLYETELPSMDLDPALLKIDQINDRAHVFVDQELVGT----LSREAQIY 482
            .:          ::.:.:...|......|..||.|.......||||:..|.||    ||.....:
plant   515 SMTRDKTDYFWYFTDITIGSDESFLKTGDNPLLTIFSAGHALHVFVNGLLAGTSYGALSNSKLTF 579

  Fly   483 S--LPLSKGWGSTLQLLVENQGRVNFYISNDT--KGIFGEVSLQLHNGGYLPLENW--------R 535
            |  :.||.|. :.|.||....|..|..:..:|  .||.|.|:|:..|.|...:..|        |
plant   580 SQNIKLSVGI-NKLALLSTAVGLPNAGVHYETWNTGILGPVTLKGVNSGTWDMSKWKWSYKIGLR 643

  Fly   536 STAFPLE----QSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGD--TYLNMAG 594
            ..|..|.    .|||:.|              .:..:::..|:.:..|...|..|:  ..|:|..
plant   644 GEAMSLHTLAGSSAVKWW--------------IKGFVVKKQPLTWYKSSFDTPRGNEPLALDMNT 694

  Fly   595 WGKGVAYVNGFNLGRYWPV------------AG--------------PQVTLYVPNEILKVGENS 633
            .|||..:|||.|:||:||.            ||              .|...:||...||...|.
plant   695 MGKGQVWVNGHNIGRHWPAYTARGNCGRCNYAGIYNEKKCLSHCGEPSQRWYHVPRSWLKPFGNL 759

  Fly   634 LVILE 638
            |||.|
plant   760 LVIFE 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 105/380 (28%)
BetaGal_dom4_5 <570..637 CDD:290101 28/95 (29%)
BGAL2NP_001325739.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.