DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL1

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_187988.1 Gene:BGAL1 AraportID:AT3G13750 Length:847 Species:Arabidopsis thaliana

Alignment Length:783 Identity:185/784 (24%)
Similarity:292/784 (37%) Gaps:237/784 (30%)


  Fly    13 AVSGCLIIAVMALTVGLCVGLSGDTDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPE 77
            |||...::..:..:|      ||           ::.:::....::|:....:|||.||.|:.||
plant    16 AVSALFLLGFLVCSV------SG-----------SVSYDSRAITINGKRRILISGSIHYPRSTPE 63

  Fly    78 SWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICA 142
            .|...:|..:..||:.:.|||.|:.|.|..|:|.:||..|:|||:::.|:...|:.||.|||:||
plant    64 MWPDLIRKAKEGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCA 128

  Fly   143 ERDNGGLPHWLFTKY-PSIKMRTNDPNYISEVGKWYAEL--MPRLQHLFVGNGGKIIMVQVENEY 204
            |.:.||.|.||  || |.|..||::..:.:::.::..::  |.:.:.||...||.||:.|:||||
plant   129 EWNFGGFPVWL--KYIPGISFRTDNGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEY 191

  Fly   205 G--DY---ACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIENVFATTDFGIDRINEID 264
            |  :|   |....|.||.                     .||:.|        ...|:.      
plant   192 GPMEYELGAPGRSYTNWA---------------------AKMAVG--------LGTGVP------ 221

  Fly   265 KIWAMLRALQPTGPLVN---------------------SEFYPGWLTHWQEQNQRRDGQEVA-NA 307
              |.|.:......|::|                     :|.:.||.|.:......|..:::| :.
plant   222 --WVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYRPAEDMAFSV 284

  Fly   308 LRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAG---------- 362
            .|.|....:.:|.||:.||||||.|||..:          ..|||||||.:||.|          
plant   285 ARFIQKGGSFINYYMYHGGTNFGRTAGGPF----------IATSYDYDAPLDEYGLERQPKWGHL 339

  Fly   363 ----------------GVTTKYNL---------------VKAVIGEFLP--------------LP 382
                            |..|:..|               ..|.:..:.|              ||
plant   340 KDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLANYNPKSYAKVSFGNNHYNLP 404

  Fly   383 --EITLNP-AKRLAYGRVEL---TPKLTLLSTEGRAALS----KGDP-------------VESIK 424
              .|::.| .|...|....:   |.::.::.......||    ..||             ||.|.
plant   405 PWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQIN 469

  Fly   425 P----------KTFEELDLYSGLVLYETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSREA 479
            .          .|..::|...|. |...:||:       |.:.......|||::.:|.|:.....
plant   470 TTRDTSDYLWYMTDVKVDANEGF-LRNGDLPT-------LTVLSAGHAMHVFINGQLSGSAYGSL 526

  Fly   480 QIYSLPLSKGWG-----STLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRST 537
            ....|...||..     :.:.:|....|..|.  :......|:.|.|||...|||...| :|:..
plant   527 DSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDL-SWQKW 590

  Fly   538 AFPL----EQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGDTYL--NMAGWG 596
            .:.:    |..::.......:.|.|....:|:::     |:.:..:......||:.|  :|...|
plant   591 TYKVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQ-----PLTWYKTTFSAPAGDSPLAVDMGSMG 650

  Fly   597 KGVAYVNGFNLGRYWPV--------------------------AGPQVTLYVPNEILKVGENSLV 635
            ||..::||.:|||:||.                          ...|...:||...||...|.||
plant   651 KGQIWINGQSLGRHWPAYKAVGSCSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGNLLV 715

  Fly   636 ILE 638
            :.|
plant   716 VFE 718

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 108/393 (27%)
BetaGal_dom4_5 <570..637 CDD:290101 23/95 (24%)
BGAL1NP_187988.1 PLN03059 10..847 CDD:166698 185/784 (24%)
Glyco_hydro_35 40..344 CDD:279624 104/353 (29%)
Gal_Lectin 769..846 CDD:280328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.