DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and BGAL9

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_565755.1 Gene:BGAL9 AraportID:AT2G32810 Length:887 Species:Arabidopsis thaliana

Alignment Length:797 Identity:196/798 (25%)
Similarity:307/798 (38%) Gaps:222/798 (28%)


  Fly    22 VMALTVGLCVG---LSGDTDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRL 83
            :::|.:.|.|.   |||....|     |.:.::....::.|:....||...||.||.||.|...:
plant    14 ILSLIIALLVYFPILSGSYFKP-----FNVSYDHRALIIAGKRRMLVSAGIHYPRATPEMWSDLI 73

  Fly    84 RTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGG 148
            ...:..|.:.:.|||.|:.|.|..|:||:||..|:|||:::......|:.||.|||:|||.:.||
plant    74 AKSKEGGADVVQTYVFWNGHEPVKGQYNFEGRYDLVKFVKLIGSSGLYLHLRIGPYVCAEWNFGG 138

  Fly   149 LPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQH--LFVGNGGKIIMVQVENEYGDYACDH 211
            .|.|| ...|.|:.||::..:..|:.|:..:::..::.  ||...||.|||:|:||||||....:
plant   139 FPVWL-RDIPGIEFRTDNEPFKKEMQKFVTKIVDLMREAKLFCWQGGPIIMLQIENEYGDVEKSY 202

  Fly   212 -----DYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKI---ENVFATTDFGIDRINEIDKIWA 268
                 ||:.|        .:..||.....:|  .:.|.:.   ||:       ||..|..     
plant   203 GQKGKDYVKW--------AASMALGLGAGVP--WVMCKQTDAPENI-------IDACNGY----- 245

  Fly   269 MLRALQP---TGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNASV-NLYMFFGGTNF 329
            .....:|   |.|::.:|.:.||.|.|......|..:::|.|:........|. |.||:||||||
plant   246 YCDGFKPNSRTKPVLWTEDWDGWYTKWGGSLPHRPAEDLAFAVARFYQRGGSFQNYYMYFGGTNF 310

  Fly   330 GFTAGANYNLDGGIGYAADITSYDYDAVMDEAG-------------------------------- 362
            |.|:|..:.          ||||||||.:||.|                                
plant   311 GRTSGGPFY----------ITSYDYDAPLDEYGLRSEPKWGHLKDLHAAIKLCEPALVAADAPQY 365

  Fly   363 ---------------GVT-------------------TKYNLVKAVIGEFLPLP----------- 382
                           |.|                   .|:|      |:...||           
plant   366 RKLGSKQEAHIYHGDGETGGKVCAAFLANIDEHKSAHVKFN------GQSYTLPPWSVSILPDCR 424

  Fly   383 EITLNPAK-------------RLAYGRVELTPKLTL---LSTEGRAALSKGDPVESIKPKTF--- 428
            .:..|.||             |.:.|.:.:..|:..   :|...::.::..:|:.......|   
plant   425 HVAFNTAKVGAQTSVKTVESARPSLGSMSILQKVVRQDNVSYISKSWMALKEPIGIWGENNFTFQ 489

  Fly   429 ---EELDL---YSGLVLYETELPSMDLDPALLK---------IDQINDRAHVFVDQELVGTLSRE 478
               |.|::   .|..:.::|.:...:.|.:..|         ||.:.|...|||:::|.|::...
plant   490 GLLEHLNVTKDRSDYLWHKTRISVSEDDISFWKKNGPNSTVSIDSMRDVLRVFVNKQLAGSIVGH 554

  Fly   479 --AQIYSLPLSKGWGSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGYLPL--ENWRST 537
              ..:..:...:| .:.|.||.:..|..|:  ::..|..|..|:..|.....|.|.|  .:| :.
plant   555 WVKAVQPVRFIQG-NNDLLLLTQTVGLQNYGAFLEKDGAGFRGKAKLTGFKNGDLDLSKSSW-TY 617

  Fly   538 AFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTE----VGDTYLNMAGWGKG 598
            ...|:..|.:::..|| :|||....|....    .|.::....|..:    .....||:...|:|
plant   618 QVGLKGEADKIYTVEH-NEKAEWSTLETDA----SPSIFMWYKTYFDPPAGTDPVVLNLESMGRG 677

  Fly   599 VAYVNGFNLGRYWPVAG--------------------------PQVTLY-VPNEILKVGENSLVI 636
            .|:|||.::||||.:..                          |..|.| ||...||...|.||:
plant   678 QAWVNGQHIGRYWNIISQKDGCDRTCDYRGAYNSDKCTTNCGKPTQTRYHVPRSWLKPSSNLLVL 742

  Fly   637 LEYQRAN------KTAT 647
            .|....|      ||.|
plant   743 FEETGGNPFKISVKTVT 759

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 111/402 (28%)
BetaGal_dom4_5 <570..637 CDD:290101 24/98 (24%)
BGAL9NP_565755.1 PLN03059 37..877 CDD:166698 188/770 (24%)
Glyco_hydro_35 44..348 CDD:279624 107/337 (32%)
BetaGal_dom4_5 640..>689 CDD:290101 13/53 (25%)
Gal_Lectin 799..876 CDD:280328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.