DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and si:dkey-224e22.2

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_009292108.1 Gene:si:dkey-224e22.2 ZFINID:ZDB-GENE-061207-59 Length:646 Species:Danio rerio

Alignment Length:615 Identity:224/616 (36%)
Similarity:325/616 (53%) Gaps:65/616 (11%)


  Fly    51 EANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGI 115
            ::..|.|.|.|||.:.||.||||.....||.||..::|.|||.|.|||.|:||.|..|.|.::..
Zfish    53 DSTHFTLAGAPFRILGGSIHYFRVPRAHWRDRLLKLKACGLNTLTTYVPWNLHEPERGVYVFQDQ 117

  Fly   116 ADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAEL 180
            .|:..::.:|.|.|.::|||||||||||.|.||||.||. :...:|:||....:.|.|..::.:|
Zfish   118 LDLEAYIRLAAELDLWVILRPGPYICAEWDLGGLPSWLL-QDKKMKLRTTYSGFTSAVNSFFDKL 181

  Fly   181 MPRLQHLFVGNGGKIIMVQVENEYGDYACDHDYLNWLRDE-TEKYVSGKALLFTVDIPNEKMSCG 244
            :||:..|....||.||.||||||||.||.|..||:.:::. ..:.:|  .||.|.| ..|.:.||
Zfish   182 IPRITPLQYKKGGPIIAVQVENEYGSYAKDEQYLSVVKEALMSRGIS--ELLMTSD-NREGLKCG 243

  Fly   245 KIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALR 309
            .::.|..|.:.......::..    |..|||..||:..|::.||...|.|.:.....||:.:.:|
Zfish   244 GVDGVLQTVNLQKLSYGDVQH----LAELQPQKPLMVMEYWSGWFDVWGELHHVFSAQEMISIVR 304

  Fly   310 TILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAV 374
            .:|....|:|.|||.||::|||.:||   :|.|. |....:||||||.:.|:|..||||:|::::
Zfish   305 ELLDRGVSINFYMFHGGSSFGFMSGA---VDLGT-YKPQTSSYDYDAPLTESGDYTTKYHLLRSL 365

  Fly   375 IGEFLPLPEITLNPA--KRLAYGRVELTPKLTL------LSTEGRAALSKGDPVESIKPKTFEEL 431
            :..:...| |...||  .|..|..|.:|..::|      :.|..||    .|||      :.|.|
Zfish   366 LSSYSKEP-ILEPPAVQSRRVYEPVVVTQHISLWESLQCVETSFRA----DDPV------SMENL 419

  Fly   432 DLYS------GLVLYETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSREAQIYSLPLSKGW 490
            ...:      |..||:|::.|   ...|...:.:.|||.||:|:||:|.|....|...:|.||. 
Zfish   420 PANNNNGQSYGYTLYQTDIYS---GGELNSRNHVRDRALVFIDRELIGVLDYRTQKVKIPQSKS- 480

  Fly   491 GSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSAV-ELWRRE 552
            ..||.|||||.||||:  .:.:..||:.|:::|:     .:||:.:......::...: .|..|:
Zfish   481 ERTLSLLVENCGRVNYGPALDSQQKGLVGDITLE-----NVPLKKFTMHCLDMKPGFINRLQSRK 540

  Fly   553 HT--DEKALDPLLARQRILRNGPILYTGSLTVTEVGDTYLNMAGWGKGVAYVNGFNLGRYWPVAG 615
            .|  .||.            ..|..:.|||.|.:..||::.:..|.|||.:|||.||||:|.| |
Zfish   541 WTSVSEKP------------TYPAFFRGSLVVDQPTDTFIKLPNWSKGVVFVNGQNLGRHWSV-G 592

  Fly   616 PQVTLYVPNEILKVGENSLVILEYQRANKT 645
            ||..||:|...||.|||.:::.|..:|.:|
Zfish   593 PQKALYLPGPWLKTGENEIIVFEEFKATET 622

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 131/323 (41%)
BetaGal_dom4_5 <570..637 CDD:290101 31/67 (46%)
si:dkey-224e22.2XP_009292108.1 Glyco_hydro_35 57..359 CDD:279624 129/314 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13177762
eggNOG 1 0.900 E1_COG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128163
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.