DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and GLB1L

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001273352.1 Gene:GLB1L HGNCID:28129 Length:654 Species:Homo sapiens

Alignment Length:667 Identity:254/668 (38%)
Similarity:343/668 (51%) Gaps:83/668 (12%)


  Fly    17 CLIIAVMALTVGLCVGLSGDTDAPEEQPR-FTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWR 80
            ||...::.|::.|.:        |:...| |.:|...:.|:|||.||||||||.||||.....|.
Human     8 CLRSLLLPLSLTLLL--------PQADTRSFVVDRGHDRFLLDGAPFRYVSGSLHYFRVPRVLWA 64

  Fly    81 SRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERD 145
            .||..||.|||||:..||.|:.|.|..|.||:.|..|::.||..|...:..:|||||||||||.:
Human    65 DRLLKMRWSGLNAIQFYVPWNYHEPQPGVYNFNGSRDLIAFLNEAALANLLVILRPGPYICAEWE 129

  Fly   146 NGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDY-AC 209
            .||||.||..| |.|.:||:||::::.|..|:..|:|::......|||.||.:|||||||.| ||
Human   130 MGGLPSWLLRK-PEIHLRTSDPDFLAAVDSWFKVLLPKIYPWLYHNGGNIISIQVENEYGSYRAC 193

  Fly   210 DHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIENVFATTDFGIDRINEIDKIWAMLRALQ 274
            |..|:..|.......:..|.||||.|.| |.:.||.:..::.|.|||  ..:.:.||:.:||..:
Human   194 DFSYMRHLAGLFRALLGEKILLFTTDGP-EGLKCGSLRGLYTTVDFG--PADNMTKIFTLLRKYE 255

  Fly   275 PTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNL 339
            |.|||||||:|.|||.:|.:.:..|....|...|..:|...||||:|||.||||||:..||    
Human   256 PHGPLVNSEYYTGWLDYWGQNHSTRSVSAVTKGLENMLKLGASVNMYMFHGGTNFGYWNGA---- 316

  Fly   340 DGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAVIGEFL-----PLPEITLNPAKRLAYGRV-- 397
            |....:....|||||||.:.|||..|.|...::.||.:|.     |||.    |:.::..|.|  
Human   317 DKKGRFLPITTSYDYDAPISEAGDPTPKLFALRDVISKFQEVPLGPLPP----PSPKMMLGPVTL 377

  Fly   398 ----ELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELDLYSGLVLYETELPSMDLDPALLKI-- 456
                .|...|.||...|        |:.||.|.|||.:....|.:||.|.:.....:|....:  
Human   378 HLVGHLLAFLDLLCPRG--------PIHSILPMTFEAVKQDHGFMLYRTYMTHTIFEPTPFWVPN 434

  Fly   457 DQINDRAHVFVDQELVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNF-YISNDTKG-----I 515
            :.::|||:|.||....|.:.|..: ..|.|:...||.|.:||||.||::| ..|:|.||     |
Human   435 NGVHDRAYVMVDGVFQGVVERNMR-DKLFLTGKLGSKLDILVENMGRLSFGSNSSDFKGLLKPPI 498

  Fly   516 FGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSL 580
            .|:..|.......|.::|.....|||:   :..|......               :||..|:.:.
Human   499 LGQTILTQWMMFPLKIDNLVKWWFPLQ---LPKWPYPQAP---------------SGPTFYSKTF 545

  Fly   581 TVT-EVGDTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEIL--KVGENSLVILEYQRA 642
            .:. .||||:|.:.||.||..::|||||||||...|||.|||||..:|  :...|.:.:||.   
Human   546 PILGSVGDTFLYLPGWTKGQVWINGFNLGRYWTKQGPQQTLYVPRFLLFPRGALNKITLLEL--- 607

  Fly   643 NKTATGEDL---PAVQF 656
                  ||:   |.|||
Human   608 ------EDVPLQPQVQF 618

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 150/323 (46%)
BetaGal_dom4_5 <570..637 CDD:290101 31/70 (44%)
GLB1LNP_001273352.1 Glyco_hydro_35 38..353 CDD:307464 150/323 (46%)
BetaGal_dom4_5 527..605 CDD:315929 32/93 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13203404
eggNOG 1 0.900 E1_COG1874
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 495 1.000 Inparanoid score I1380
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D179316at2759
OrthoFinder 1 1.000 FOG0001881
OrthoInspector 1 1.000 T130262
orthoMCL 1 0.900 OOG5_128163
Panther 1 1.100 O PTHR23421
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.