DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and Glb1l

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_083286.1 Gene:Glb1l MGIID:1921827 Length:646 Species:Mus musculus

Alignment Length:636 Identity:250/637 (39%)
Similarity:342/637 (54%) Gaps:65/637 (10%)


  Fly    42 EQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPH 106
            |...|.:|.|.:.|:|||.||||||||.||||..|..|..||..|:.|||||:..||.|:.|.|.
Mouse    22 EARSFVVDREHDRFLLDGVPFRYVSGSLHYFRVPPVLWADRLLKMQLSGLNAVQFYVPWNYHEPE 86

  Fly   107 DGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYIS 171
            .|.||:.|..|::.||..|.:.:..:|||||||||||.:.||||.||. :.|:|.:||:||.::.
Mouse    87 PGIYNFNGSRDLIAFLNEAAKVNLLVILRPGPYICAEWEMGGLPSWLL-RNPNIHLRTSDPAFLE 150

  Fly   172 EVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDY-ACDHDYLNWLRDETEKYVSGKALLFTVD 235
            .|..|:..|:|::......|||.||.:|||||||.| |||..|:..|.......:..|.||||.|
Mouse   151 AVDSWFKVLLPKIYPFLYHNGGNIISIQVENEYGSYKACDFKYMRHLAGLFRALLGDKILLFTTD 215

  Fly   236 IPNEKMSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRD 300
            .|: .:.||.::.::.|.|||  ..:.:.:|:::||..:|.|||||||:|.|||.:|.:.:..|.
Mouse   216 GPH-GLRCGSLQGLYTTIDFG--PADNVTRIFSLLREYEPHGPLVNSEYYTGWLDYWGQNHSTRS 277

  Fly   301 GQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVT 365
            ...||..|..:|...||||:|||.||||||:..||    |....:....|||||||.:.|||..|
Mouse   278 SPAVAQGLEKMLKLGASVNMYMFHGGTNFGYWNGA----DEKGRFLPITTSYDYDAPISEAGDPT 338

  Fly   366 TKYNLVKAVIGEFL-----PLPEITLNPAKRLAYGRVELTPKLTLLS------TEGRAALSKGDP 419
            .|...::.||.:|.     |||.    |:.::.:|.:.::....|||      .:|        |
Mouse   339 PKLFAIRNVISKFQEIPLGPLPP----PSPKMKFGPLTMSLDGNLLSFLDFLCPQG--------P 391

  Fly   420 VESIKPKTFEELDLYSGLVLYETELPSMDLDPALLKI--DQINDRAHVFVDQELVGTLSREAQIY 482
            :.|:.|.|||.:.|..|.:||.|.|.|..|:|....:  :.|:|||:|.||..|.|.|.|..: .
Mouse   392 IHSVLPLTFEAVKLDHGFMLYRTYLTSPVLEPTPFWVPNNGIHDRAYVMVDGVLKGVLERSLK-Q 455

  Fly   483 SLPLSKGWGSTLQLLVENQGRVNFYIS-NDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSAV 546
            .|.|:...|:.|.:|:||.||::|..: :|.||:.....|     |...|..|  ..|||:...:
Mouse   456 ELYLTGTVGTRLDILLENMGRLSFGSNHSDFKGLLEAPLL-----GQTILTEW--MMFPLKVDKL 513

  Fly   547 ELWRREHTDEKALDPLLARQRILRNG---PILYTGSLTVTE-VGDTYLNMAGWGKGVAYVNGFNL 607
            ..|         ..||...:|.|...   |..|:....|.. :|||:|.:.||.||..::|||||
Mouse   514 VKW---------WFPLQLMKRALPQASSVPAFYSAKFPVFGLLGDTFLYLPGWTKGQVWINGFNL 569

  Fly   608 GRYWPVAGPQVTLYVPNEILKVGE--NSLVILEYQRANKTATGEDLPAVQF 656
            ||||.:.|||.||||| .:|..|.  |.:.:||.:.....      |.|||
Mouse   570 GRYWTMRGPQQTLYVP-RLLLFGRSINKITLLELENVPHN------PQVQF 613

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 148/323 (46%)
BetaGal_dom4_5 <570..637 CDD:290101 31/73 (42%)
Glb1lNP_083286.1 Glyco_hydro_35 34..349 CDD:279624 148/323 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13180321
eggNOG 1 0.900 E1_COG1874
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 508 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001881
OrthoInspector 1 1.000 T131024
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23421
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.