DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and TJP1

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_016878010.1 Gene:TJP1 HGNCID:11827 Length:1878 Species:Homo sapiens

Alignment Length:570 Identity:108/571 (19%)
Similarity:190/571 (33%) Gaps:224/571 (39%)


  Fly   133 ILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVG--NGGKI 195
            ||||...:..           |.|..|:.:|....|   :||.:.|.::........|  .|.:|
Human   510 ILRPSMKLVK-----------FRKGDSVGLRLAGGN---DVGIFVAGVLEDSPAAKEGLEEGDQI 560

  Fly   196 IMVQVENEYGDYACDHDYLNWLRDETEKYVSGKALLFTVDIP-NEKMS--CGKIENVFATTDFGI 257
            :.|.          :.|:.|.:|:|        |:||.:|:| .|:::  ..|.::|:.      
Human   561 LRVN----------NVDFTNIIREE--------AVLFLLDLPKGEEVTILAQKKKDVYR------ 601

  Fly   258 DRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDG-----QEVANALRTILSYNAS 317
             ||.|.|               |...||  ..||::.:.:...|     .||...:.|:  ||..
Human   602 -RIVESD---------------VGDSFY--IRTHFEYEKESPYGLSFNKGEVFRVVDTL--YNGK 646

  Fly   318 VNLYMFFGGTNFGFTAGANY-NLDGGI----GYAADITSYDYDAVMDEAGG-----------VTT 366
            :       |:......|.|: .::.||    ..|..:.|..| .:...|||           .::
Human   647 L-------GSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQY-TLPKTAGGDRADFWRFRGLRSS 703

  Fly   367 KYNLVKAVIGEFLPLPEITLNP--AKRLAYGRVELTP-----KLTL---LSTEGRAALSKGDP-- 419
            |.||.|:       ..:::..|  .|..||.||.|..     .:|:   ::...|..|::.:|  
Human   704 KRNLRKS-------REDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDI 761

  Fly   420 --VESIKPKTFEELDLYSGLVLYETELPSMDLDP-ALL-----KIDQINDRAHVFVDQELVGTLS 476
              :...:|:........||::...|....:|.|. |||     .:|::|                
Human   762 YQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLN---------------- 810

  Fly   477 REAQIYSL-----PLSKGWGSTLQLLVENQGRVNFYISNDTKGIFGEVSLQLHNGGYLPLENWRS 536
             .||.|.:     |.||....|:::.:..:.|                                 
Human   811 -YAQWYPIVVFLNPDSKQGVKTMRMRLCPESR--------------------------------- 841

  Fly   537 TAFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGDTYLNMAGWGKGVAY 601
                  :||.:|:.|.|             ::.:|...|:|.::.:..:.|      ||...:  
Human   842 ------KSARKLYERSH-------------KLRKNNHHLFTTTINLNSMND------GWYGAL-- 879

  Fly   602 VNGFNLGRYWPVAGPQVTLYVPNEILKVGENSLVILEYQRANKTATGEDL 651
                                  .|.::..:|.||.:...:|: .||.:||
Human   880 ----------------------KEAIQQQQNQLVWVSEGKAD-GATSDDL 906

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 58/269 (22%)
BetaGal_dom4_5 <570..637 CDD:290101 10/67 (15%)
TJP1XP_016878010.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.