DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and TMPPE

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001034859.2 Gene:TMPPE HGNCID:33865 Length:453 Species:Homo sapiens

Alignment Length:319 Identity:65/320 (20%)
Similarity:110/320 (34%) Gaps:97/320 (30%)


  Fly   395 GRVELTPKLTL---LSTEGRAALSKGDPVESIKPKTFEELDLYSGLVLYETELPSMDLDPAL--L 454
            |.:|.|.||.|   |:....|.||....:.:.:|...:.:           |:|...|..::  |
Human   154 GSLEKTRKLVLRPALAVGVTAVLSVAGILNAAQPPAVKTV-----------EVPIHQLPASMNNL 207

  Fly   455 KIDQIND----------RAHVFVDQELVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNF--- 506
            ||..::|          :..:||  .:|..|..:..:....||....|.|:..|...|:::.   
Human   208 KIVLLSDIHLGPTVGRTKMEMFV--RMVNVLEPDITVIVGDLSDSEASVLRTAVAPLGQLHSHLG 270

  Fly   507 ---------YISNDTKGIFG---EVSLQ-LHN-----------------GGYLPLENWRSTA--- 538
                     |.::|....|.   .:.:| |||                 |.....|:|...|   
Human   271 AYFVTGNHEYYTSDVSNWFALLESLHVQPLHNENVKISATRAQRGGGGSGSGSEDEDWICLAGVD 335

  Fly   539 -------------FPLEQSAVELWRREHTDEKALDPLLARQRILRNGP---ILYTGSLTVTEVGD 587
                         ..|:: |:|....:||........||.:|.|:..|   ::.:|.   |..|.
Human   336 DIEADILHYSGHGMDLDK-ALEGCSPDHTIILLAHQPLAAKRALQARPDINLILSGH---THAGQ 396

  Fly   588 TY-LNMAGWGKGVAYVNGFNLGRY------WPVAGPQVTLY-VPNEILKVGENSLVILE 638
            .: ||:|.:     .:|.|..|.|      :....|....| :|..:....|.:.:||:
Human   397 IFPLNVAAY-----LLNPFFAGLYQVAQATFVYVSPGTAYYGIPMRLGSRAEITELILQ 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624
BetaGal_dom4_5 <570..637 CDD:290101 16/78 (21%)
TMPPENP_001034859.2 MPP_YkuE_C 206..449 CDD:277331 50/254 (20%)
Metallophos 207..393 CDD:278574 37/192 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13203876
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.