DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and glb1l

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001015958.1 Gene:glb1l XenbaseID:XB-GENE-964696 Length:648 Species:Xenopus tropicalis

Alignment Length:614 Identity:251/615 (41%)
Similarity:347/615 (56%) Gaps:48/615 (8%)


  Fly    46 FTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEY 110
            |.||.|.|.|..|||||||:|||.||.|.....|:.||..|:.:||:|:.|||.|:.|....|.|
 Frog    30 FEIDFEHNCFRKDGQPFRYISGSIHYSRVPQYYWKDRLLKMKMAGLDAIYTYVPWNFHETKPGVY 94

  Fly   111 NWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGK 175
            |:.|..|:..||::|.|....:|||.|||||||.|.||||.||..| .||.:|::||:|:..|..
 Frog    95 NFSGDHDIESFLKLANEIGLLVILRAGPYICAEWDMGGLPAWLLAK-ESIVLRSSDPDYLQAVDN 158

  Fly   176 WYAELMPRLQHLFVGNGGKIIMVQVENEYGDY-ACDHDYLNWLRDETEKYVSGKALLFTVDIPN- 238
            |....:|:::.....|||.||.||||||||.| .||::||..|......::..:.:|||.|... 
 Frog   159 WMGVFLPKMKPFLYHNGGPIISVQVENEYGSYFTCDYNYLRHLLQLFRHHLGDEVVLFTTDGSGL 223

  Fly   239 EKMSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQE 303
            :.:.||.|:.::.|.|||..  :.:.:.:::.|..:|.|||||||||.|||.||.|.:.....:.
 Frog   224 QYVRCGTIQGLYTTVDFGPG--SNVTETFSVQRYCEPKGPLVNSEFYTGWLDHWGEPHSVVATEM 286

  Fly   304 VANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKY 368
            |..:|..||::.|:||:|||.||||||:..|||      ..||...|||||||.:.|||.:|.||
 Frog   287 VTKSLDEILAHGANVNMYMFIGGTNFGYWNGAN------TPYAPQPTSYDYDAPLSEAGDLTDKY 345

  Fly   369 NLVKAVIGEFLPLPEITLNP-AKRLAYGRVELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELD 432
            ..|:.||.::..:||..:.| ..:.|||.:::....|:  ||....|:....::...|.||:::.
 Frog   346 FAVREVIKKYKQIPEGPIPPTTPKYAYGEIKMEKVKTV--TEALDILASHGAIQGTYPLTFDQMK 408

  Fly   433 LYSGLVLYETELPSMDLDPALLKI--DQINDRAHVFVDQELVGTLSREAQIYSLPLSKGWGSTLQ 495
            .|.|.|||.|.||....:|..|..  :.:.|||:|.|:....|.|.|:.|. ::.::...|:.|.
 Frog   409 QYFGFVLYRTTLPINCSNPTTLTTLSNGVQDRAYVTVNGVPQGVLERDKQT-AINVTGVAGAELD 472

  Fly   496 LLVENQGRVNF-YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLE-QSAVELWRREHTDEKA 558
            ||||:.||||| ..:||.||:...|:|   ||..  |.||  |.:||: .|||.           
 Frog   473 LLVESMGRVNFGRYNNDFKGLLTNVTL---NGEL--LVNW--TMYPLDIDSAVN----------- 519

  Fly   559 LDPLLARQRI----LRNGPILYTGSLTV-TEV----GDTYLNMAGWGKGVAYVNGFNLGRYWPVA 614
             ..||:...|    ..:.|:.|.|||.: |.:    .||::...||.||..::|||||||||||.
 Frog   520 -GGLLSTIHIPYASAFSAPMFYKGSLIIPTGIPDLPQDTFIQFPGWTKGQIWINGFNLGRYWPVR 583

  Fly   615 GPQVTLYVPNEILKVG-ENSLVILEYQRA 642
            |||||||||..||... .|::.:||.:.:
 Frog   584 GPQVTLYVPRSILTTTLVNNITVLELENS 612

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 146/324 (45%)
BetaGal_dom4_5 <570..637 CDD:290101 35/73 (48%)
glb1lNP_001015958.1 Glyco_hydro_35 39..353 CDD:279624 146/323 (45%)
BetaGal_dom4_5 <539..607 CDD:290101 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13177910
eggNOG 1 0.900 E1_COG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D179316at2759
OrthoFinder 1 1.000 FOG0001881
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.