DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and Glb1l2

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_017451348.1 Gene:Glb1l2 RGDID:1564436 Length:692 Species:Rattus norvegicus

Alignment Length:695 Identity:235/696 (34%)
Similarity:352/696 (51%) Gaps:89/696 (13%)


  Fly     1 MSGCRRNRKLTMAVSGCLIIAVMAL-TVGLC----VGLSGDTDAPE----------------EQP 44
            :..|.|...|::.|....:::|:.| ....|    ||.|..:...|                ::.
  Rat    35 VGSCDREGALSLRVFMLNVLSVLFLAAASACSSPAVGPSPGSSNEESHLSRLNWTSVLPLWLQRQ 99

  Fly    45 RFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGE 109
            |..:..:...|||:...|:.:.||.||||...|.||.||..::|.|||.|.|||.|:||.|..|:
  Rat   100 RLGLRTKGPNFMLEDSTFQILGGSIHYFRVPREYWRDRLLKLKACGLNTLTTYVPWNLHEPERGK 164

  Fly   110 YNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVG 174
            :::.|..|:..|:.:|.:...::|||||||||:|.|.||||.||. :.|.:|:||..|.:...|.
  Rat   165 FDFSGNLDLEAFIWLAAKIGLWVILRPGPYICSEIDLGGLPSWLL-QDPDMKLRTTYPGFTKAVD 228

  Fly   175 KWYAELMPRLQHLFVGNGGKIIMVQVENEYGDYACDHDYLNWLRDETEKYVSGKAL--------L 231
            .::..||.|:..|...:||.||.||||||||.|..||.|:.:::         |||        |
  Rat   229 LYFDHLMSRVVPLQYKHGGPIIAVQVENEYGSYNGDHAYMPYIK---------KALEDRGIIEML 284

  Fly   232 FTVDIPNEKMSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQN 296
            .|.| ..:.:..|.::.|.||  ..:....|:..:.::|.::|...|.:..|::.||...|...:
  Rat   285 LTSD-NKDGLEKGVVDGVLAT--INLQSQQELVALNSILLSIQGIQPKMVMEYWTGWFDSWGGSH 346

  Fly   297 QRRDGQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEA 361
            ...|..||...:..|:...:|:|||||.|||||||..||.:..|    |.||:|||||||::.||
  Rat   347 NILDSSEVLQTVSAIIKDGSSINLYMFHGGTNFGFINGAMHFGD----YKADVTSYDYDAILTEA 407

  Fly   362 GGVTTKYNLVKAVIGEFL-----PLPEITLNPAKRLAYGRVELTPKLTLLSTEGRAALSKGDPVE 421
            |..|.||..::.:.|.|.     |.||:|    .::.|..|  ||...|...:  |.|....|:.
  Rat   408 GDYTAKYTKLRELFGTFSGVPPPPPPELT----AKMVYEPV--TPSFYLSLWD--ALLYMDKPIT 464

  Fly   422 SIKPKTFEELDLYS------GLVLYETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSREAQ 480
            |..|...|.|.:.:      |.|||||.:.|..:...|     :.||..||:::..:|.|.....
  Rat   465 SEIPINMENLPVNNGNGQAFGYVLYETTIFSSGVLSGL-----VRDRGQVFLNRVSIGFLDYTTT 524

  Fly   481 IYSLPLSKGWGSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQ 543
            ..::||::|: :.|::||||:||||:  .|.:..||:.|  :|.|:|   .||:|::..:..:.:
  Rat   525 KITIPLTQGY-TILRILVENRGRVNYGNNIDSQRKGLIG--NLYLNN---KPLKNFKIYSLDMTK 583

  Fly   544 SAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTV-TEVGDTYLNMAGWGKGVAYVNGFNL 607
               :.::|...|:.::.|    :.|  ..|..:.|:|:| ....||:|.:.||.|||..||..||
  Rat   584 ---QFFQRFDMDKWSVVP----KEI--TFPAFFLGTLSVGIYPSDTFLKLEGWVKGVVLVNDHNL 639

  Fly   608 GRYWPVAGPQVTLYVPNEILKVGENSLVILEYQRANKTATGEDLP 652
            ||||.| |||.|||:|...|..|.|.::|.|...|.......|:|
  Rat   640 GRYWNV-GPQETLYLPGVWLDKGLNKVIIFEETMAGSMVQSTDIP 683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 129/330 (39%)
BetaGal_dom4_5 <570..637 CDD:290101 32/68 (47%)
Glb1l2XP_017451348.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13180121
eggNOG 1 0.900 E1_COG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128163
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.